Skip to main content

Full text of "The Works of Shakespear: In Eight Volumes"

See other formats


Google 



This is a digital copy of a book that was preserved for generations on library shelves before it was carefully scanned by Google as part of a project 

to make the world's books discoverable online. 

It has survived long enough for the copyright to expire and the book to enter the public domain. A public domain book is one that was never subject 

to copyright or whose legal copyright term has expired. Whether a book is in the public domain may vary country to country. Public domain books 

are our gateways to the past, representing a wealth of history, culture and knowledge that's often difficult to discover. 

Marks, notations and other maiginalia present in the original volume will appear in this file - a reminder of this book's long journey from the 

publisher to a library and finally to you. 

Usage guidelines 

Google is proud to partner with libraries to digitize public domain materials and make them widely accessible. Public domain books belong to the 
public and we are merely their custodians. Nevertheless, this work is expensive, so in order to keep providing tliis resource, we liave taken steps to 
prevent abuse by commercial parties, including placing technical restrictions on automated querying. 
We also ask that you: 

+ Make non-commercial use of the files We designed Google Book Search for use by individuals, and we request that you use these files for 
personal, non-commercial purposes. 

+ Refrain fivm automated querying Do not send automated queries of any sort to Google's system: If you are conducting research on machine 
translation, optical character recognition or other areas where access to a large amount of text is helpful, please contact us. We encourage the 
use of public domain materials for these purposes and may be able to help. 

+ Maintain attributionTht GoogXt "watermark" you see on each file is essential for in forming people about this project and helping them find 
additional materials through Google Book Search. Please do not remove it. 

+ Keep it legal Whatever your use, remember that you are responsible for ensuring that what you are doing is legal. Do not assume that just 
because we believe a book is in the public domain for users in the United States, that the work is also in the public domain for users in other 
countries. Whether a book is still in copyright varies from country to country, and we can't offer guidance on whether any specific use of 
any specific book is allowed. Please do not assume that a book's appearance in Google Book Search means it can be used in any manner 
anywhere in the world. Copyright infringement liabili^ can be quite severe. 

About Google Book Search 

Google's mission is to organize the world's information and to make it universally accessible and useful. Google Book Search helps readers 
discover the world's books while helping authors and publishers reach new audiences. You can search through the full text of this book on the web 

at |http: //books .google .com/I 



^ 



> 



.\ ' 



s 



THE 



WORKS 



O F 



SHAKESPEAR: 



VOLUME the THIRD. 



CONTAINING, 

All's Well, that Ends Well. 

T w E L p T H-N I o H T : Or^ What you will» 

^tbc Comedy ^Errors, 

Tie Wl N T E R-N I O H T 'S T A L E. 

^Tbe Life and Death of King John. 




^^, VA^ 




LONDON: 

printed for y. and P. Knttpton^ S, Birt^ T. Longman and 
r. ibtweUy H. Lintott^ C Hitcb^ J. BrindUf^J. and R. Ton^ 
JiB 4iid S.Dtafery R. IVellingtm, E.Niw^ and & Dod. 

MDCCXLVH 



f 



£ R R A T A« 

' Pa§;e 2f . L ptnu]^ fir tegdher read, togecfier. p. 77. 1. -16. y»r I 

fvtfW riL* p» >!• 1.^9. ^ I^U read IM. p. 944. 1. ai./«r it 16 rMif 

'^ishis. p. 164. 1. %\, fir aadhe.tQuft i^ad and his mull, p. 217. 

1* iti^fi^ >^ ''^^ **• P* ^^5* '* 17- i^ <>7n*s ''^tf^ tyring, p. 360* 
1. 17. /tfr Col. rrtf4f Clo, p, 4H* I* penult, fir b«y rM^ bj, p. 469. 
l^^iu fir UL re0d tiVi. • 



t 
9 







A L L s WELL, 



THAT 



» « 



ENDS WELL 




\ 



Vot. III. 



B 




DRAMATIS PERSONjE. 

KING ^/France. 
Duke of Florence. 
Bertram, Count of RoufiUon. 
Lafeu, an old Lord. 

Parotles» a parafitkal follower of Bcrttzm '9 atowardy 
but vain^ and a great pretendep /# valom. 

Several young French Lords^ tbatferve with Bertram in 
the Florentine war. 

Clown ' f ^^^'^^^^ ^^ ^^^ Qmntefs of RoufiUon. 

Countefs of RoufiUon, mother to Bertram. 

Helena, daughter to Gerard de Narbon, a famous 

pbyfician^ fome timeftnce dead. 
An old widow of Florence. 
Diana, daughter jp the ^dowi^ 

M^wna! f ^^^^^^Sy andfHenit h the widow. 
Lordsy attending on the King ; Officers j Soldier s^ txc. 

SCENE lies partly in France ; andy partly 

in Tufcany. 






All's JVelh that Ends WelL 

ACT I. SCENE I. 

TTse Comtefs of Roufilloi'i Hotife in France. 

Eater Bertram, the Ceutilefs of Roufillon, Helcta, 
and Lafcu, all in I" 



C o u M T £ s s. 

■ S N diflcvering my fon from me, I buiy 
2 a fecond husband. 

I Ber. And I in going, Madam, weep 
I o'er my father's death anew; but I muu 
attend his Majcfly's command, to whom 
I am now in ward, evermore in fubjc^ion. 

Laf. You fhall find of the King a husband, Ma- 
dam ; you. Sir, a father. ' He, thu fo generally is at 
all times good, mult of necclfity hold his virtue to 

I h ati.iviii«a my Jsn from mt ] To Jiliwr fnm. In 

Ac fenfe of gr-jing up, ia not Englifh. Shtiiejptar wrote, in 
KiiSEvEKitiG Off JtK fiam mi -The following Words, too, 

■ i burj a fieand huibani—— demand this reading. For to 
itfftvtr implies a violeni divorce i and therEfbre might bs com.- 
pared to the iurfii^ « buthunJi which, Jihvtrivg doei not. 

B a you} 



Airs nvelh that Ends w//. 

you ; ^ whofe worthinefs would ftir it up where k 
wanted, rather than flack it where there is fuch abun-- 
dance. 

Count. What hope is there of his Majefty^s amend*^ 
ment? 

Laf. He hath abandoned his phyficians. Madam, 
under whofe practices he hath persecuted tinie with 
hope I and finds no other advantage in the proceft, 
but only the iofing of hope by time. 

Count. ' This young gentlewoman had a fiuher, 
(O, thsxbad! how fad a Prefage 'tis ! ) whofe skill 
was almoft as great as his honefty ; had it ftretch*d b 
far, it would have made nature immortal, and death 
fhould have play'd for lack of work. 'Would, for 
the king's fake, he were living! I think, it would 
be the death of the King's difeafe. 

Laf. How call'd you the man you fpeak of. 
Madam? 

Count. He was famous. Sir, in his profeiBon, and 
it was his great right to be fo : Gerarade Narhn. 

Laf. He was excellent, indeed. Madam ; the King 
very lately fpoke of him admiringly, and mourningly : 

2 nvbofi iJOQrthiui/s ivouIJ fiir it up mthiri ii moamiidp rather 
than lack it mthtn then is fuch abtrndmnce^'] An Oppofitioil of 
Terms is vifibly defignM in this fentence; tho* theOppofition it 
not fo vifible, as the Terms now Hand. Wmmttd and Ahtndancs 
are the Oppofites co one another; but how is iaek a Contraft tQ 
ftir up? The Addition of a fingle Letter gives it, and the very 
Senfe requires it. ^tiAJlack it, 

3 This young gifitlenjceaan had a father ( O, that had I hty 
fad a PASSAGE Vii/] Lafeu was fpeakin^ of the King*s defpe^ 
rate Condition: which makes the Coanteis recall to mind. the de- 
ceafed Gerard de Narhon^ who, ihe chinks, coald have cured him* 
But in uiing the word hady which implied his death, (he ftopt in 
the middle of her fentence, and makes a reflexion npon it, which» 
according to the prefent reading, is unintelligible. We muft there* 
fore believe Zhahf^ear wrote ( O that had ! how (ad a f a B s a c B 
*tis } I. /. a Prefage that the King mull now exped no cure, fince 
fo skilful a Perfon was himfelf forced to fubmit to a maUgnanC 
didemper* 

ht 



M'smieM, that EhJs nt^ff. 

it was skilful encnigh to have liv'd ftiJI, if knowledge 
oooki be fJBt upflfpiinft mortality^ 

&r. What is ic» tny good ferd, the King Ian- 
guiiaies of? 

Laf. A fiftula, mj lord. 

Bn^. I heard not of it before. 

Laf» I would, it were not notorious.* Was this 
gpitfewoman the dai^hter of Gerard de Narbon I 

Count. His fole child^ my lord, and bequeathed to 
my overlooking. I have thofe hppes of her good^,^ 
that her education pronrrifes her; diTpoHtion fhe in- 
bericsy which Riakes fair gifts fairer; for ^ where ah^ 
ncleao mind carries virtuous qualities^ there, com- 
meodations go with pity ; they are virtues and traitorar 
ttx>: in her they are the better for herfimplenefs; fhe 
derives her honefty, and atchieves her goodnefi. 

4 ^uhtn an unclean mind carriit virtuous pfalifiis, fhere, 
mmmmdaiiam 99 Hviihpiipi t/^ip are Virines ^i Traitors too: im 
htr tbe^ 0re tbe httitr fyr r n%i%JmfUneJs i Jhi dtri'uts hir Bo^, 
n^» and aicbinm hir poinffs^ This obfcare cncomiom if 
Bttdo MI more ob(cuR by a uight oorroption of the ttti. Let 
as explain the pal&ge as it lies, ^y nnrtnous qaafities ane meaoti 
qinlides of good breeding and erudition ; in the iame fenfe that 
toe Italians ia)r> fualita 'vtrtuofa ; and not moral ones. On this' 
Kconat It is» file iays, that, in an ill mind, thefe virtuous qualities^ 
art virtuts and traitors too: i. e. the advantages of edacationT 
oafaie an ill aind to go farther in wickedneft tl^n it could have'' 
<ioiie whhottt them : But, fays, the Countefs, in her they are thf 
letter fir rHti%Jtmpienefs, ^\xx fimfltnefs b the fame with what 
ii called i&Mr^y innnediately after; which cannot be predicated 
of the qualities of education. We mnft certainly nad 

B B R ^n^len^s 1 

Aad then tbe fentence is properly ooocluded. The .CouQitr& haf 
^f thht virtuous qualities are the worfe for an andean mind, 
bat concludes that neM% are iYsthetterfir herJimpUuefs, i. e. her 
clean, jpure mind. She then fums up the Charafler, (he had before 
given m detail, in thefe words, fie derintes her honejlj, and at^ 
Sieves her goodne/sf /. e. She derives her honejfyt her jmplene/st 
utx moral Chara^er, from her Father and Anceftors : But (he at- 
chives or wins hex toodnefs^ her virtue, or her qualities of good- 
iMiefihg and erudiuon, by her own pains and labour. 

B 3 La/- 



^ Mlt^elh *fi^. ^Us 'uielh . 

Z#/. Your commendatioosy Madauv get iroalier 
tears. 

. QcunL ^Tis the beft brine a maiden c^ feafoa her 
praife in. The remembrance of her father never ap- 
proaches her hearty but the tyranny of her forrows 
takes all livelihood from her check. No more of 
1^1$, Helena^ go to, no more v left it be rather thought 
you afied a forrow^ than to have it. 

Uil. I do affe^ a forroWs indeed, but I havA it 
too. 

^rl^f. fi4<?derate lamentatUm k the right of the deadt. 
c^x^effive grief the enemy to the living. 
. Cmni. f IF the living be not enemy to the grief„ 
1^ exceis ai%I(;es it foon mprtal. . . 

fia^. Madaniy I defire your holy wifhe$. 

Laf, How undarftand we that? 

Coun/. Be thou bleft, Bertram^ and fucceed tny 
fiither 
In manners as In fhape ! thy blood and virtue 
Contend for empire in thee, and thy goodncft 
Share with thy birtb-right ! Love all, trull a few. 
Do wrong to none : be able for thine enemy 
leather in power, than ufe \ and keep thy friend 
tJnder thy own life*s key : be checked for filence. 
But never tax'd for fpeech. What heaven more will. 
That thee may famifti^ and my prayers pluck down, 
Fall, on thy head I Farewel, ipy lord ; 
' Fis an uniieaibn'd courtier, good my lord^ 
Advife him. 

Laf. He cannot want the be.ft^ 
That fliall attend his love. 

• • • 

5 If the RviHg he entmy to the piffi fhe ixce/s makes it fotn 
mortal."] This feems very obfcore ; out the addition of a Nega- 
tive perfedUy difpcis all the mift. If the liviug be not enemy. Sec, 
e^ceflive grief i$ an enemy to the living, fays Lafeu: Ye.% 
replies theConntefs; and if the living be not enemy to the grief^ 
^i. fp ftrive to conquer it, J the exceis makes it foon mortal. 

Count. 



AlVsnikU^ that Ends ^L^ ^ 

Cmu. Hcav'n bids him! Farewei, Bertram. 

\^Exit Ctmntefs. 

Bir. {fh. Hcl] Tite beft wilhe», ehaf cart be forg'd- 
in your thought^ be ^kf\r% to you ! ^rdtufbrtable 
to my tMUhtCy your miftrefs, and fhake much of 
her. 

Ltf/ Fiwwel, prttty Jtfdy, ydu muft hold thi' 
credit <rf* your father. [£jf«r;« Bertram ^ LalfcuV 

SCENE .II.. 

Hel. Oh, were that all! ——I think not on my 
father; ' • 

And thefe great tears gratt hi$ remembrance more. 
Than thole I Ihed for him. What was he fikc ? 
I have forgot him. My im&ginitfon 
Carries no favour in it, but my Bertram*s. 
I am undone •, there is Jio living, none. 
If Bertram be aWay. It Were all one. 
That 1 fhould love a bright particMar ftaf^ 
And think to wed it ; he is fo above me: 
In his bright radiance ^ and collateral light 
Muft 1 be comforted, not m his ^ere. 
Th* ambition in my love thus plagues itfelf ; 
The hind, that would be mated by the Iion» 
Muft die for love. 'Twas pretty, tho* a plague. 
To fee him every hour ; to fit and draw 
His arched brows, his hawking eye, his curls. 
In our heart's table : heart, too capable 
Of every line and trick of his fweet favour ?— 
But now he's gone, and my idolatrous fancy 
Muft finftify his relicks. Who comes here ! 

6 anJ collateral tight.] c^Uatiral for rtfitSti. i. f. in the 

ndiance of his rtfitSei light; not in his Jphen^ or ilnB light. 
Mikon uib the w»rd, in the fame fenfe, fpeaking of the Son, 
Of high colkctral Gkrj. Book lo. v. 86. 

B 4 Enter 



AtVs'mUy that B^ds 'ofett. . 

* 'i 

Enter Parollcs, 

One, tbit goes wkh him : I love him for his fake, 

*^ And vet I know him a nocorious liar ; 

V Think hio) a great way fool, folely a coward i 

^< Yet thefe fix'd evils fit fo fit in him, 

** That diey cake place, when virtue's fteely bones 

^ Look bleak in the cold wind ;" full oft we fee 

i Cold wifdom waiting on fqperfluous folly. 

S C E N E ni- 

... 

Pan Save you, fair Queen« 

HcL And you, Monarw*. 

Par. No, 

Hel. And no. ■ ■ - ^ 

Par. Arc you meditating on virginity ? 

HeL Ay: you have feme *'ftain of foldier in youi 
let me ask you a queflion. Man is enemy to virgi* 
nity, how may we harricado it againft him ? 

Par. Keeplum out. 

HeL But he aflails ; and our virg^ity, tbo' valiant^ 
in the defence yet is weak : unfold to us Ibme warlike 
refiftancc. 

Par. There b none: man, fetting down before 
you, will undermine you, and blow you up. 

HeL Blefs our poor virginity from undermincrs and 
blowers up ! — — Is there no military policy, how 
virgins might blow up men ? 

Pflr. Virginity being blown down, man will quick- 
lier be blown up: marry, in blowing him down 
again, with the breach yqurfelves made, you lofe 

7 Cold noi/HoM ivaiiing on fuperflaoos/b/Jr.] CoIJfor naked ; at 
/uferfluous for over-doath*d. This makes che propriety of the 
Antithefis. 

8 Stain of fMitr] fain for colour. ParolUs was in red, u 
appears from his being ^Tterwards called nd-trnVi bumble bet. 

your 



AU's nueU^ that Ends mxU. ^ 

your dty. It is »Qt politick in die commonwealth 
of nature, to preferve viiginity. Lofs of virginity 
is lacional tncttafe; and there was never virgin got, 
*tiil virginity was firft loft. Tlxat^ you ^wne made of, 
is metal tomake virgins. Vit^inity, bybdog ooceloft, 
may be ten times foand: by being ever kept, it is 
ever kift ; His too coid a txxnpanion : away with*t. 

Hel. I will ftand for^t a little, though diercficm I 
die a virgin. 

Par, There's liftle can be laid in't ; 'tis againft die 
rule of nature. To fpeak on the part of virginity^, 
is to acculb your mother ; which is moft infallible dtib* 
bedience. As ' he, that ha^gs himielf, fb is a virgin: ^ 

* virginity murthers icfelf, and ihould. be buried in 

* highways but of all lan&ified limit, as a deiperate' 
' ofiendrefs againft. nature. Virguiity breeds mites» 
' much like a cheefe ; confumes itfelf to the very 
' paring, and fo dies with feeding its own fiomach. 

* Befides, virginity is peevifh, proud, idle, made of 

* lelf-love, which is the maSi prohibited ftn in the 
^ canon. Keep ic not, you cannot chufe but loft 
^ by't. Out with't; within ten years it will make 

* itielf two^ which is a goodly incrcaie, and the 

* principal itielf not much the worfe. Away wkh't. 

Hel. How might one do. Sir, to loie it to her own 
liking ? 

9 lU^ that bangs bimfilf^ it a f^irgin:] Bat why !• he tbat h&ngi 
himfelf a Virgin ? Surely^ not for the reafon that fellows, Fit^* 
nity mmrdin'itfeff'. For tho' every Virgin be a Sniciiie, yet every 
Suicide ii not « Vir|tn. A word or two are dropc, wliidi iotro^ 
duced a compariron m tiiit place i and SbahJ^ar wxoce it thaa^ 

A s Afy that batigt himfi^f so is a Firgitt^ 
And then it follows naturally, Virginitj muriirs itjtlf^ By this 
ameodatiotty the Oxfird Editor was enabled to auer the Text 
thus. 

Hi that bangs bimfi^ is Ukt a Virgin. 

And this is his ofual way of becoming a Critiek at a cheap ez- 
peace. 

Par. 



ix> AU's v)dl^ tha Ends njxlL . 

i'Psr. Lct'tne fee. M^, ili» to lile him tfatt- 
m^ it likes« *Tis a commodity wtH lob ihe glofi 
with lying. The longer kept^ the lefs worth: oS^ 
with*t, wbik *qs TcndSble. Anfwer the tune of rei 
qdeft. Virginicy^ like an old courtier, wcara her cap 
oiit of faihion : richly fated^ but unfiitable ; juft like 
the brooch and the toothpkk, whkh we wear not 
ti3W : your date is better ia your pye and y6ur por- 
ridge, than in your cheek ; and your virginity, youf 
aid virginity, is like one of our FrMtb wichcrVI poirs ; 
it looks ill, it eats drily ; marry^ 'ts a withered pear: 
it was formerly better ; marry, yet 'tis a withered 
pear. Will you any thing with it ? 

Hel. Not my virginity yet. 
There IhaU your mailer have a thoufaad Iove9» 
A mother, and a miftfefs, and a friend, / 
^ [A phoenix, captain, and at) enemy, 
A' guide, a goddels, and a foverdgn, 
A councilor, a traitrcfs, and a dear ; - , 
His bcnnble ambition, proud humility ; 
His jarring concord ; and his. di&ord dulcet ; . . . .. 
His hick, his fwect difafter ^ wkh a worklJ . 
Of pretty fond adoptions cbriftendoms. 
That btin^ing C^U goflips. Now (ball he — ] 

I J Phoenix, Captain^ fccJ\ The eight following linear betvveMi 
the hooks» I am perfuadcd is the nonfenfe of fome foolifti con* 
csittd Player. What pat it into kis head waa HeUm\ fayiag« as it 
fhouU be read for the future^ 

nitifi^ljour Mttfier have a thou/knd Uvtsi 
A Mother, tmi a Miftreft, and a Friend. 
/ >bM«ta ffB/» ixihm hifimll^""^ Gedfiui him mfiU. 
Where the Fellow findtne a thoufand loves ^ken Of, and only 
tbM Kclcoocd up» namely a M(Hher\ a Miftn/s't, and a Fnend'%^ 
(whick» by ch« way, were all a judicioua Writer could mention ; 
for there are but thcfc three fpccics of love in Nature) he would help 
out the number, by ike imaniMdiato iloafanfe: and, becaufe they 
were yet too few,, he pieces out his kvu with snmitUs, and makes 
of the whole fuch nxilfhed nonfenfe as is never heard oat of 
Bedlam, 

I 



^'s ^lifiUy tU$ Vsnis wftf. . ,, 

I koaw not, what h&fliall>^Ood feadhim well! -«^ 
Tht Courtis a Icaraing place — and he is one—- . 

Par. What one, mith ? 

H$U That I wifli wcir-^'ds pity r-*-^ 

Par, Wharfs picy? 

Hd. That wifhing well had not a hcAy in't, ' 
Which might be felt; that We the.poqrer boro» 
Whole bater ftars do (hue, us up in. wiiOhes^ 
Might wkh efieds of them follow our friends : 
And fliew what we alone aiuft think^ which never 
Returns us thanks. 

Enter Pm^. 

Page. Monficur ParolleSy 
My lord calls for you. [Eitil P^e. 

Par, Liule Hekn^ farewell if I ca» if member 
thee, I 'WiU think of thee at court. 

HeL Mon&enr ParvUes^ you were born under a' 
charita^ ftsir. 

Par. Under 7l/^i, J. 

HfL I efjpedatly thinks under jlii^r/,- 

Par. y/hyxxidsr Maps f 

HeL The wars have ^ksjt you fo under, that you 
muft need9 be bom under JMars. 

Par. When he was predominant. 

Hel. When be was irtrogiudet I think, nther. 

Par. Why think you fo? 

Hel. You go lb mmh backward, wditn you ii^it. 

Par. That's for advantage. 

HeL So is running away, when fear propofes fafety : 
but the compofition, that your valour and fear makes in 
you» * is a virtue of a good ming, and I like the wear well. 

2 is a virtue of a good wino, and I Rh tbi wear wr//.] 
The integrity of tl^ metaphor dire^ us to SbakiJ^ear^n trae read- 
ing; which, doubtleffl, was— -a good ming, i.e. mixture., 
t9WipefitioH, a word common to Sbakt/^ar and the writen of this 
age ; and taken from the texture of doch. The M was tum'd the 
wrong way at the prefs^ and from thenoe came die blunder^ 

Par. 



t S Airs viell, that Ends nueU. 

Par. I am fo fiill of buGneffis^ as I cannot anfWer 
thee acutely: I will return perfeft courtiers in the 
which, my inftru£tion IhaU ierve to naturalize thee, 
fo thou wilt be capable of courtier's counfel, and un- 
derftand what advice fhall thruft upon thee ; elie thou 
dieft in thine unthankfulnefs, and thine ignorance 
makes thee away i fiareweh When thou haft leifure, 
hy thy prayers i when thou haft none, remember thy 
friends ; get thee a good husband, and ufe him as be 
ufes thee: fo fareweK [Exit. 

SCENE IV. 

Hel. Out remedies oft in ourfelves do lie. 
Which we afcribe to heav'n. The fated sky 
Gives us free fcope ; only, doth backward pull 
Our flow defigns, when we ourfelves are dull. 
What power is it, which mounts my love fb high. 
That makes me fee, and cannot feed mine eye ? 
The mightieft fpace in fortune nature brings : 
To join like likes ; and ki(s, like native things, 
hnpoffible be ftrange attempts, to thofe 
That weigh their pain in^fenie; and do fuppofe. 
What hath been, cannot be. Who ever ftrove 
Tofliew her merit, that did mtfs her love? 
The King's difeafc — my projedfc may deceive me, ^ .; 
But my intents are fix*d, and will not leavt me. 



SCENE 



ASi*s tuiUy that Ends nuelL 13 

SCENE V. 

Changes to the Cburt of France. 

Flourijb Comets. Enter the King «j^ France vntb Utters^ 

and iruers Attendants. 

iwy.'TP HE Florentines and Senoys are by th* caw % 
jL Hx7t fougbt with equal fortune, and continue 
A bcavins war j 

J Lord! So 'tis reported. Sir. 

King. Nay, 'tis moft crniible ; we here receive it, 
A certainty vouched from our coufin A^ria ; 
With caution, that the Florentine will move us 
For fpcedy aid ; wherein our dcarcft friend 
Prejudicates the bufinefs, and would ieem 
To have us make denial. 

I Lord. His love and wifdom,. 
Approved fo to your Majefty, may plead 
For ample crecfence. 

King. He hath armM our anfwer % 

nd Florence is deny*d, before he comes: 

et, for our gentlemen that mean to fee 
The Tufcan fervicc, freely have they leave 
To ftand on either part» 

.2 Lord. It may well fcrve 
A nurfcry to our gentry, who are lick 
For breathing and exploit. 

JDng. What's he comes here? 

Enter Bcmtm^ Lafcu nnd Paroll«f. 

I Lord. It is the count Rotj/Slon^ my good lord» 
young Bertram. 

King. Youth, thou bcar'ft thy father's face. 
Prank nature^ rather curious than in hafte. 

Hath 




1 4 All's <u)elly that Ends nnelL . 

Hath well composed thee. Thy father's moral parts 
May'ft thou inherit too ! Welcome to Paris. 

Ber. My thanks and duty are your Majefty's. 

King, r would, I had that corporal foundncfs now. 
As when thy fether and myfelf in friendfliip 
Firft try'd our foldierfhip : he did look far 
Into the fervice of the time, and wa$ 
Diicipled of the brav'ft. He lafted long ; 
But on us both did ' haggifli age fteal on. 
And wore us out of ad. It much repairs me 
To talk of your good Either ; in his youth 
He had the wit, which I cm well obferve 
To day in our young lords ; but they may jeft. 
Till their own fcom return to them unnotecf, 
^ Ere they can hide their levity in honour : 
^ So like a courtier, no contempt or bittcrnefs 
Were in him \ pride or fharpnefs, if there were. 
His equal had awak'd them \ and his honour. 
Clock to itfeif, knew the true minute when 
Exceptions bid him fpeak ; and at that time 
His tongue obeyed his hand. Who were below him 

3 haggi/bBigtJfealan,] j^^ which debilitates; alluding lo 

the fuperflitioos of beinjg ha^idden in the Epialtis ; which coming 
giadually on^ it was fai<C the mtchjioii upon them. 

4 En tbty can hid£ their len)ity in honour:'] i. e. Cte their titles 
can cover the levity of their behaviour, and make it pafi for dc- 
fert. The Oxford Editor, not uad«rftaiiding this, alters the line to 
Ere they catt «oye their Unuty tuitb his honour. 

5 So like a Cwrtier, no Contewtft or Bittemeft 
IVere in his friie or Shmrfmefi i if they w#r#, 

Hii Ettual had awak'd them, ] This Paflage is fo vtry 

incorreflly pointed, that the Author's Meaning is loft. As the 
Text and Stops are reformM, thefe are moil beautiful Lines, and 

the Senfe is this '* He had no Contempt or Bitternefa \f he 

•* had any thing that looked like Pride or Sbarpnefs. (of which 
" Qualities Contempt and Bitternefs are the Bxoefbs,) his Eiqual 
*< had awdc*d them, ndt hb Inferwr ) to whom he fcorn'd to 
'* difcover any thing that bore the Shadow of Pride or Sharp* 

He 



«( 



AU'i <u»klh that BtdstueiL . 

* He us*d as creatures of another place. 

And bow'd his eminent top to their low ranks } 

' Making them proud ; and his humility, 

Ib their poor praife, he humbled : Such a man 

Might be a oopy to thefe younger times i 

"Which, folIow*d well, would now demonftrate them 

Bat goers badcward. 

BtTf His good remembrance^ Sir, 
Liea/icher in your thoughts, tha»on his tomb; 
So in apfKWt * lives not his epitaph. 
As in your royal fittch. rf„ 

CjSf. 'Would, (were with him! he would alwayJ 
(MeuiDKs, I hear him now } his phuflve words 
He fcatter'd not in ears, but graftctf^hem 
To grow dicre, and to bear ;) Let mV not live,-- 
(Thus his good melancholy oft b<aan. 
On the cataftrojAe and heel of p^me. 
When it was outO let me not live, (quoth he,) 
After my flame lacks oil j to be the fijuff 
Of younger Ipirits, whofc apprcbenfive fenfes 
A^I but new things difdain j whofc judgments are 
Mecr fadien of their garments j whofc conftancies 

Expire before their faihions: this he wilh'd. 

I, after him, do after him wiih too, 

(Since I nor wax, nor honey, can bring home.) 

I qoickly were diflblvcd from my hive. 

m1^\Lu^!^" '/r'^/^«.] ••• e. he »ade allow 
ST^ tkett coadoa, «d few fi«n then what he would not 

STtlSl^^inJlS^ The 0,>^ Editor. »«u„d„fl J! 

A /*nr ^ *r«e/J. b, bumbltd ] But why were they 

Food of i>M Hnmility ? It fhould be read and pointed thui ^ 

-— mttt^ tbm prnul; ah a bit HumiHtf. 
' ,"*''fr.t'»'Prai/t,btbumbitd 

^'^ifiS'l'^K*'?*"^; Th. Sentiaew^ iac. '^ 
a tntt lut bu epnaph,] tfitt^ bt AmAK. 

To 



'5 



l6 ^Vs nvelly that Ends naelL 

To give ibme ' labourer room. 

4 Lord. You're loved. Sir; 
They, that kaft lend it you, (hall lack you firft« 

lOng. I fill a place, I know*t. How long iVc, counc^ 
Since the phylician at your father's died I 
He was much &m'd. 

Ber. Some fix months fince, my lord* 

ISng. If he were living, I would try hhn yet ; *^<— 
Lend me ao arm ; — « the reft have worn me Out 
With feveral applications ; nature and fickneft 
Pebate it at their leifure. Welcome, count, 
My fon's no dearer. 

^(?r. Thank your Majefly. . {Fhurijb. Eximt. 

SCENE VL 
Changes to the Countefs' s at Roufillon. 

Enter Qwntefs^ Steward and Clown. 

Coura.X WILL now hear; what fay you of this 
X gentlewoman P 

Stew. N^dam, the care I have had to even your 
content, I wiih might be found ip the calendar of 
my paft endeavours ; for then we wound our modcfty, 
and make foul the cleamefs of our dcfervings, when 
of ourfelves we publifh them. 

Coui^. What do^ this knave here? g^t you gone. 
Sirrah: the complaints, I have heard of you,. I do 
not all believe ; 'tis my flownefs that I do not, for, 
I know, ' you lack not fblly to commit them, and 
have ability enough to make fuch knaveries yours. 

Clo. 

9 lahouren fWM.] We flioald read tahanff, i. 9* an adiv« 
fucoeflbr. 

I you fact mtfilfy H eoftmit l^iav, mni hmm MUty tamifjk H 
make/kcb bupueriu rotrits.] Weil, but if lie liad ibUy to tom^ 
mit them, he neither wanted kaattiy, nor any Mn% eife, fare, 
to maki them bis mm. Tkh MSkfenfe flioakl fat tmd, 70 mmh 

fiuh 



Ally's welly that Ends well. 17 

Clo. 'Tis MC unknown to yoa. Madam, 1 un a 
poor fcUow. 

Omt. WeU, Sir. 

CU. No» Madam ; 'tis not To well that I am poor, 
tfao* many of the rich are damn'd ; bat, if I bare 
jour kdyihip*s good will to go to the world, IM ihti 
woman and 1 will do as we may. 

Count. Wilt thou needs be a beggar? 

Ch. I do beg your good will in this cafe. 

Count. In what caft ? 

Clo. In Lhef% cafe, and mine own ; fcrvice is no he^ 
ritage, and, I thtnk, I fhall never have the blefling of 
God, *till I have liSie of my body , for they iay^ 
beams are bleffings. 

Count. Tell me thy reaibn why thou wik many. 

Oo. My poor body, Madam^ reouires ic. 1 am 
driven on by the Flefli ; and be mun: needs go, that 
the devil drires. 

Count, h this all your worlTitp*s rea&n ? 

Ch. Faith, Madam^ I have other holy reafons, tack 
as they are. 
. Count. May the world know them ? 

do. I have been. Madam, a wicked creature, ais 
you and all flefh and blood are ; and, indeed, I do 
marry, that I may repent. 

Juch kna*veriis tare ; nimble, dextrous^ r. i, Tho* joa be ibol 
*<tioQgh to comaiat knaveries, yet foa JmTe quickacis enough to 
commie them dejoroitily : for tbv oMervadon mu id let o» imo 
liis chancer. Bot now, tho* this be kt right, and, I dare iay, 
'\ii^^hakefpear*%QVin words, yet the former part of the fencenct will 
ftill he inaccurate— 'jwtt lack mft f^ly /• commit th£m. Them* 
what ? the fenfe requires knm^ria^ but the antecedent referred 
to, is €9mflaimu. Bat this was ccrtainlv a neglijrence of ^h^- 
ft^ar*^^ and therefore to be letc as we and it. And the fcad^r, 
who cannot fee that this is an loacouKcy which the Author might 
yi^\ Commit, and the other what he wnviti could, has either read 
^^tf4#^ar vary Htcle, or greatly aiifpCBt hL^ pains« The prin- 
ctfNil officfrofaciiucicii t«»diiUngiuth between thelie two things. 
But *us that branch of crittcifm which no precepts can tcsbch 
the wricer to ditcharge, or t^e reader to judf^ of. 

Vol.. III. O Crnnt. 



V 



1 8 MVs welly that Ends well. 

Cmta. Thy marriage^ (boner than tby wickednds. 

Qo. I am out of friends. Madam, and I hope to 
have friends for my wife's ^ke. 

Cwnt. Such friends are chine enemies, knave. 

Cle. V* are ihallow. Madam, in great friends ; for 
the knaves come to do that for me, which I am weary 
of; he, that eares my land, {pares my team, and gives 
me leave to inne the crop ; if I be his cuckold, he's 
my drudge ; he, that comforts my wife, is the che- 
rimer of my flefh and blood ; he, that cherilheth my 
&(h and blood, loves my flelh and blood \ he, that loves 
my flefh and blood, is my friend: ergo^ he^ that 
kifles my wife, is my friend. If men could be con- 
tented to be what they are, there were no fear in mar- 
riage ; for young Cbarbon the puritan, and old Pcyfam 
the papift, howfoc^er their hearts are levered in reli* 
gion, their heads are both one ; they may joul horns 
tog^her, like any deer i* th* herd. 

Cmmi. Wilt thou ever be a foul-mouth*d and cap 
lumnious knave ? 

Qo. ^ A prophet, I, Madam ; and I fpeak the 
truth the next way. 
^ For I the ballad will repeat, which men full true 

fhall find ; 
^ Your marriage comes by deftlny, your cuckow fings 
by kind. 

a A frtpbei^ 7, Madam \ and 1 J^ak tbi imib tbi mxi tva^.l 
It is a faperftitkn, which has run throagh all ages and people, 
that natural ffoh have fomethiag in them of divinity. On which 
account they were edeemed (acred: Travellers tell us in what 
cfteem the furks now hold them ; nor had they lefs honour 

Slid them heretofore in France^ as appears from the old word 
#«/#, for a natural fooL Hence it was chat Pantagruel^ in 
Xablais, advifed Panurg$ to go and confolt the fool Trihoulet 
«i an oracle ; which gives occafion to a facirical Stroke upon 
die privy cooncil ij^ Frauds the Firft.— Par Pawj^ conftil^ prc- 
didion da fols 'uos ffanjtz quants princes^ ^c. out ejli cpu/grvez^ 
&C.— *The phni^-^JfeaA tht truth the next 'way. means direSlji 
as they do who are only the inftrumeau or canals of others; 
fiich as infpircd perfons were fappofed to be. 






4^V ivtlh that. Bnds W4 .^ 

awn.. . ' \ \'i , . T 

Stew. May it (>leafe you» MBdaiD^ thafcjbo bi4 

£&Zf9CQa>QilP..j^»i} of her 1 am to fpeak. 
(JbMl. Swratb^tell my gendnwoman I wodl^ fpe»k 

widi beri. /^fto» I mean. 
Gf^. ^ *^ Wi^(tu$ f^ir fa^e thfi qaufe, quotb^ /he^ 

^' -Why tha GfMoas facked 7ri?^^ 

"« Food donpv^ fond dooe ; for Paris^ be^ . 

" Wa3 ^h liing Priam*s joy* 

"* With thatv ibc fighed as Ibe flood, * 

** And g4ye tbi^^ent^ce tbm% . 

'^ ^A^BODg nine. bad if one be goody .1 

^. There's yet one^ good in ten. . .4 . • 

GwtfA What> one good in tea i You corcqpt the 
loQgt Sfrrah« 

Cio. One good woman in teq^ Madam, which 19 
> fwify v)g ffn^h' ioQg : 'wquId^rOod. would fenri^che 

3 UTaf iUifiurJTaci the imafi^ f^otbjbip 
Why tie KjKOzm facked Troy } 
Fond dotUf fond done ; 

: Wdi l&h Khg PmmV9-} Tkis is a Stanza dT n dd 

billidy out of which a word or two are drobt, aqiallx ^efxflkry 
Auo^ ;h& ifinfe and .the aittcaate rhii^c ror it was not Hf^p 
w&o wis'Kine Priam z joy, but Pa///. The third line thereforg 
flwotd be read thas, 

Fofid doHiffind dtm, for Paxis, hb» 

4 >^0;^ rf/«< *«</ ^ tmi he md,- 

nirti'yet tne ^d in ten] This fecofid daAM Opthe 
iNdbd is turned to a joke opon the women: a coiifeffioii,'Jii4t 
there was one good in ten. Whereon the Counteis obferved, that 
he torropted the ftng ; which fhews the ?bng faid, Nine go^d'tn On* 

]f ane feoad amen^p mnt go9d^' • 

fhetfthkt one bad m ten, 
lliis relates to the ten Tons of Friam» whtk alt behared fheoiMvey 
weiriilit Paris. For, tho' he once had fifty» yet at thfe^mtforiB- . 
«ate peribd of hfs retgn he had but ten; Jgatkony iHttphprn, 
l>ehhohust Dins, He^or, He/enus, Hiffo^kvus, FemrnQM, Buru^ 



i^ 



I 



20 AlVf 'wUy that "Ends fwell. 

world fo all die year ! we*4 find no fauk with the 
tythe-woman, if I were the Parfon; one in ten, 
quoth aM an we might have a good woman born but 
every blazing ftar, or at an earthquake, 'twould mend 
cbe lottery wdl ( a man may draw his heart ovt, ere 
he pluck one. 

Count. You'll be gone, Sir knave, and do as I 
command you ? 

Clo. That man that (ho\dd be at a woman's com- 
mand, and yet no hurt done ! tho' honefty be no pu- 
ritan, yet it will do no hurt ; it will wear die furplis 
of humility over the black gown of a big heart: I 
am going, forfooth, the bufinefs is for Helen to come 
hither. lExif. 

Count. Well, now. 

Suw. I know. Madam, you love your gendewoman 
intirely. 

dmt. Faith, t do ; her father bequeathed her to 
me ; and flie herfelf, wkhout other advantages, may 
lawfully make title to as much love as (he finds ; there 
is more owing her, than is paid ; and more fliall be 
paid her, than fhe'U demand. 

SUv). Madam, I was very late more sear her, 
than, I thiok, ihe wifh*d tnei alone ifae was^ and 
did communicate to herielf her own words to her 
own ears; fhe thought, I d&re vow for her, thqr 
touch'd not any ftranger ienfe. Her matttr was, fhe 
lov'd your fon ; Fortune, ihe iaid^ was no Goddefs, 
that had put fudi difference betwixt their two eftates $ 
Love, no God, that would not extend his might, only 
where qualities were level ; ^ Diana^ no Queen oif 
Virgins, that would fuffcr her poor Knight to be fur- 
priz*d without refcue in the firft aflault, or ranfom 
afterward. This (he delivcrM in the moft bitter touch 
of forrow, that e'er I heard a virgin exclaim in; 

^ Diana added by Mr, TbiobaU. 

which 



AlVsnmU^ that tatdi ^tft. 2f 

I held k mj dotf fpM}ify to acquaint you 
withal ; ikteioe, ia the lofs that may happen, it ccmi- 
cems yoo ibmething to know ir. 

Count. You have di&bargM this honeftly, keep \t 
to yoarfidf ; many likelihoods tnformM me of this 
before, which hung k tottering m the balance, that 
I could neither believe aor mifijoubt; pray you, 
kave me; flail this in your bofbfti, and I thank yoo 
for your honeft care ; I will ^eak with you further 
anon. ^Exis Stewards 

SCENE VII. 

Enier Helena. 

Count. Ev'n fo it was with me, when I was young ; 
If we arc natufe*s, thcfe are ours : this thorn 
Doth to our rofc of youth rightly belong \ 

Our blood to us, this to our blood, is born ; 
It is the Ihow and feal of nature's truth, 
Where love's firong paffion is impreft in youth ; 
By our remembrances of days foregone, 
^ Such were our faults, or then we thought them 

none. 
Her eye is fick on*t 5 I obferve her now, — — . 

HeL What is your plcafure. Madam ? 

Ount. Helen^ you know, I am a mother to you. 

HeL Mine honourable miftrcfs. 

Count. Nay, a Mother ? 
Why not a mother ? when I faid a mother, 
Methought, you faw a ferpent ; what's in mother. 
That you ftart at it? I fay, Pm your mother ; 

6 Such njceri our faults , o R tb%n nvs tbeugbt ihtm nont ] Wc 
ihould read^ 

■ / then we thought them none. 

A motive for pitv and pardon ; agreeable to fad, and the indul- 
gent charadter of the fpeaker. This was fent to the Oxford Editor, 
and be altered 0» co tbo\ 

C 3 And 



2 1 jUtPs ^elU that Ends nvelL 

And put you jq the catalogue of thofe. 
That were enwombed mine ; *cis often feen> 
Adoption drives with nature ; and choice breeds 
7 A native flip to us from foreign feeds. 
You ne*er opprqft me with a mother *8 groan » 
Yet I exprefs to you a mother's cafe : 
God's mercy ! maiden, do's it curd thy blood. 
To fay, I am thy mother ? what's the matter. 
That this diftemper'd mefienger of wet^ 
The many-colour'd /w, rounds thine eyes ? 
Why, that you are my daughter ? 

Uel. That I am not. 

Count. I fay, I am your mother. 

HeL Pardon, Madam. 
The Count RouJiHon cannot be my brother ; 
I am from humble, he from honour'd, name \ * 
No note upon my parents, his all noble. 
My mafter, Yny dear lord he is % and I 
His iervant live, and will his vaflal die: 
Ht muft not be my brother. — — 

Count. Nor I your mother? 

HcU You are my mother, Madam 5 Vould you 
were, 
(So that my lord, your fon, were not my brother) 
Indeed, my n^other ! • — or were you both our mothers 
(I Caa no more fear, than I do fear heaven,) 

So 

7 A naffvefllp to us from foreign feeds.] Th6 integrity of the 
Jnetaphor re<|uiies we ihoald read steads, i. ^. docks, ftools, 

}ils tney are called by the gardeners,) frQm whence yoMTigJlips or 
uckers are propagated. And it is not unlikely that Shake/ftar 
might write it fo. 

8 ' or fWireyou both our mothers 

7 CARS no more poa, than I do for hea^n^ 
So I nvere not hisfifler:'] The fecond lin? has not the Icaft 
glimittering of fenfe Heient by the indulgence and invitation of iier 
ikiftrefs, is encouraged to difcover the hidden caufe of her grief} 
which is the love of her midrefs^s fon; and taking hold of her 
Duilrf f&*9 Wor^^i wl^ere (foe N> h^r ^ her mtb^r^ Ihe unfolds 

4(« 



^"s luell, that Ends nvelL 2 

So I were not his lifter : can't no other. 

But I your daughter, he muft be my brother? — 

CtnM. Ycsj Hclefiy you might be my daughter- 
in-law ; 
God Ihield, you mean it not, daughter and mother 
So ftri ve upon your pulfe ! what, pale again ? 
My fear hath catch'd your fondneb.— Now I (ee 
' The myftery of your Jonelinefs, and find 
Your iak tears* head ; now to all fenfe 'tis grofs, 
You love my (on ; invention is afham'd, 
Againft the proclamation of thy pafllon. 
To lay, thou doft not i therefore tell me true ; 
But tell me then, 'tis fo. For, look, thy cheeks 
Confeis it one to th'other ; and thine eyes 
See it lb groflv ihown in thy behaviour. 
That in their Kind they fpeak it : only (in 
And hellifli obftinacy tie thy tongue. 
That truth (hould be fufpeded ; fpeak, is't fo ? 
If it be fo, you've wound a goodly clew : 
If it be not, forfwear't ; however, I charge thee, 
As heav'n ihall work in me for thine avail. 
To tell me truly. 

Hel. Good Madam, pardon me. 

Couni. Do you love my fon ? 

Hel. Your pardon, noble miftrefs. 

Couni. Love you my ion ? 

HeL Do not you love him. Madam ? 

Cawa. Go not about ; my love hath in't a bond, 

the myftitj: aod, aa (he is difcoveriDg it, emboldens herfelf by thia 
reflexion, in the line in queftion, as it ought to be read in a paren- 
thefis, 

(/ CAK no more fear, than I do fear Jbia<v*tit) 
I. /. I can no more fear to truft fo indulgent a miArefs with the 
fecret than I can fear heaven who has my vows for its happy ifTue. 
This break, in her difcovery, is exceeding pertinent and fine. 
Here again the Oxford Editor does his part. 

^,The myfitry of your lovelinefs,] We fhould read lonelimfi^ or 
deught in loiitude, as is the humour of lovers. 

C 4 Whereof 



^4 ^'^'^ '^^s thsf tMdi njHft, 

Whereof the iKuM takte vMt : cMie, cotne^ dlfcl^ 
The ftate of your affeftion $ fcr your |)afliDni 
Have to the h\l appeach'd, 

HeL Then, I confeft. 
Here on my knee, before high hedv'ns and yoa. 
That before you, and next unto high heav'n, 
I love yotrr fon : 

My friend^ wert poor, but honeft 5 fo^s my love ; 
Be not offended ; for it hurts ndt him. 
That he is lov*d of me n I follow him ftot 
By any token of prefumptuous fuit $ 
Nor would 1 have him, 'till I do deferve hito j 
Yet never know« how that defert (hall be. 
I know, I love in vain ; drive againft hope % 
Yet, in this captious and intenible fieve, 
1 ftill pour in the waiters of my love. 
And lack not to k>fe ftill ; thus, /;f^'^»*like. 
Religious in mine error, I adore 
Tha fun that looks upon hi» worfblpper. 
But knows of him no more. My deareft Madam, 
. JjCt not your hate incounter with my love. 
For loving where you do ; but if yOurfelf, 
Whofe aged honour cites a virtuous youth, 
Pid ever in lb true a flame of Kking 
Wiib chaftly, and love dearly ^ that your Dion 
Was both herfelf and love 5 O then, giv^ pity 
To her, whofe ftate is fuch, that cannot chufe 
But lend, and give, where fhe is fure to lofe ; 
That ieeks not to find that, which (earch implies 1 
Butt riddle-like, lives fwcctly, where (he dies. 

Count. Had you not lately an intent, fpeak truly. 
To goto Paris? 

Hel Madam, I had. 

Count. Wherefore? tell true. 

HeL I will tell truth ; by Grace itfelf, I fwear. 
You know, my father Mi me fome prefcripcions 
Pf rare and prov'd effcfls \ fuch as his re^din^ 

And 



Ali's ^mUt that tnis nveU. ^5 



And manifeft o^rieiice had coUedfid 
For general (byVeigncy ; and that he wiird md. 
In hetdfbU'ft refervation u$ beftow them,^ 
As notesy whofe facukies inclufirt were. 
More than tfaey were in note : anxmgft the reft. 
There is a remedy, approved, fet down^ 
To cure the defperace larfgpifhifigs, whereof 
The King is rendered ioft. 

C&tmi. Thin was your* motive for Piif /V, was it, 
fpeak^ 

H0I. My lord yoiir fbn made me to think of thid 1 
Elfe Paris^ and the medicine^ &nd the King, 
Had from the omrer&tioD of my thoi^hcs. 
Haply been abfentthen. 

Ccunt. Bat think you^ Helefff 
If you ihould tender your ' fuppofed aid, 
Ht would receive it ? he and his phyficians 
. Are of a mind } he, that they cannot help him : 
They, that they cannot hdp. How fliall they credit 
A poor ufdearntod tirgin, when * the fchook, 
EmbowelI'd of their dodkrine, have left off 
The danger to hlclf ? 

Hel. ' There's fomething hints 
More than m^ &Cher*s skil^^ (whidh was the great'ft 

1 '-"^fitpfo/ed aid,"] fuppofed for propping, fupportxog. 

Z — tbefcbbols 

Embowcird of their do^rhe,'^-^'] the expreffion is beaad- 
foDy fiuiricaly and impliet, thic tlie theories of the fchools are 
fpim out of the bowels of the profefibrs, like the cobwebs of the 

3 Thete^sjomitbh^ in't 

More than my father's skill 

-^ that bit good reaipt^ &c.] Here is an Inference, 

[tbai'\ without airy thing preceeding, to which it refers, which 
makes the fentence vicioos, and (hews that we fhonld read, 
^bere^ i fomething nivrs 
More than my fathers skills ■ 
■ that bis good receipt — 

/. i^ I hav^ a fecret premointion Or prefage. 

Of 



^ 6 AlVs 'welly that Ends "well. 

Of his Profeffion,) that his good receipt 

Shall for my legacy be fani^ified 

By ch' luckieft ftars in heav*n ; and, would your honour 

But give me leave to try fuccels, I*d venture 

The welMoft life of mine on his Grace's Cure, 

By fuch a day and hour. 

Count. Doft thou believ't ? 

Hel. Ay, Madam, knowingly; 

Count. Why, Helen^ thou uult have my leave and 
love; 
Means and attendants ; and my loving greetings 
To thofe of mine in Court. Pll ftay at home. 
And pray God's blefling into thy attempt : 
Begone, to morrow } and be fure of this. 
What I can help thee to, thou ihalt not mils. 

[Eiceunt. 



A C T II. S C E N E I. 

Tie Court £^ France. 

Enter the Kir^^ with divers young Lords taking kave 
for the Florentine war. Bertram and Parolles. 

Flourijh Cornets. 

Kino. 

FArewel, young Lords : thefe warlike principles 
Do not throw from you : you, my Lords, farewel ; 
Share the advice betwixt you. If ooth g^in. 
The gift doth ftrctch itfcif as 'tis received. 
And is enough for both. 

I Lord. 'Tis our hope, Sir, 
After weil-enter'd foldiers, to return 
And find your Grace in health. 

King. 



AlVs ^elly that Ends njuett. 27 

Kitf* No, no, it cannot be ; and yet my heart 
Will not confefi, it owns the malady 
That doch my life befiege ; farewel, yoang Lords i 
Whether 1 live or die, be you the fons 
Of worthy Frenchmen ; ' let higher Italy 
(Thofe 'bated, that inherit but the Fall 
Of the laft Monarchy ;) fee, that you come 
Na to woo honour, txit to wed it ; when 
The biaveft Queftant fhrinks, find what you feek. 
That Fame may cry you loud : I fay, farewel. 

2 Lard. Health at your bidding ienre your Majefty ! 

King. Thofe girls of // J$r,— — take heed of them ; 
They fay, our French lack language to deny. 
If they demand : beware of being captives. 
Before you Icrve. 

Both. Our hearts receive your warnings. 

King. Farewel. Come hither to me. [To Attendants. 

[Exit. 

1 Lprd. Oh, my fweet Lord, that you will day 

behind us! — — 
Par. *Tis not his fault ; the fpark — — 

2 Lord. Oh, *tis brave wars. 



lit higher Italy 



{Thoft haiti^ that inherit hut the Tail 

Of the laji MeMoreiy}) fee^^cJ] Tliis is obfeore. Itafy^ 
at the time of this fceoe, was under .three very difierent tenures. 
The emperor, as focceiTor of the Romam emperors, had one part; 
the pope, by a pretended donation firom Cenjiantiney another ; and 
die third was composed of free ftates. Now by the lafi monarchy 
ii meant the Raman, the hft of the fonr general monarchies. 
Upon the fidl of this monarchy, in the fcramUe, feveral cities (et 
op for themfelvcs, and became free fbtes: nowthefe might be 
wd properly to inherit the fy/l of the monarchy. This being 
premiied, let us now confider fenfe. The King iays, higher 
Italy ; gifing it the rank of preference to France ; but he cor- 

teds himfeirand fays, I except thofe from that precedency, who 
pnly inherit the ^11 of the laft monarchy ; as all the little petty 
fates ; for mftance, Florence to whom thefe voluntiers were going. 
As if he had faid, I give the place of honour to the emperor and 
ikt pope, but not to tb^ free {l^tes. 

Par. 



28 AU'snveUy thai Ends ^mett. 

Par. Moft ftdmirabk % I have ftcB thofe wars. 

Ber. I am commanded here^ and kept a coil ^h» 
^00 young J and /^Jv next year j and Vili /^ «ir^.— ^ 

Par. An thy mind fland to ic^ boy, fteal away 
bravcJy. 

Ber. Shall I (lay here the forehorfe to a fmtek^ 
Creeking my iboes on the plain mafonry, 
'Till Honour be bought up^ and no fword worn 
But one to dance with ? by hea;t'n 111 fteal away. 

1 Lord. There^s honour in the theft. 
Par. Commit it. Count. 

2 Lord. I am your acceffiry, and fo fareweL 
Ber. I grow to you, and our parting is a tortur*d 

body. 

1 Lord. Farewel, Captain. 

%Lord. Sweet Moroeur Parolles ! 

Par. Noble heroes, my fword and yours are kin % 
good fparks and luftrous. A word, good metals. You 
ihall find in the regiment of the Spiniu one captain 
Spurio with his cicatrice, an emblem of war, here on 
his finifter cheek } it was this very fword entrenched 
it; fay to him, I live, and obferVe bis reports of 
me. 

2 Lord. We (haU» noble captaia 

Par. Mars doat on you for his novices ! what will 
ye do? 

Ber. Stay ; the King — [^Exeunt Lords.. 

Par. life a more fpacious ceremony to the noble 
Lords, you have reftrain'd yourfelf wkhin the lift of 
too coldf an adieu ; be more expreffive to them, for 
* they wear themfelvcs in the cap of the time, there, 
to mufter true gate, eat, ipeak, and move under the 

inBuence 

2 they nvear ihttnjel*ves in the cap of the time, there ^ d o mufter 
true pate t &c.3 The main obfcurity of this paflngearires from the 
iniilake of a dngle letter. We (hould read, inflead of, do mufter^ 

f o mufter » 7i nvear themfelves in the cap of the time, figtlilles 

to be the fbiemoft in the ftfliion : the figurative alla/Iott is to the 

galantiy 



Alt's "w^y that Ends nmfl. 29 

miimce of the moft received ftar ; and tho* t)he 
dnril lead the meafure, fuch are to be foUow'd : after 
them, and Cake a more dilated farewel. 

Ber. And I will do fo« 

Par. Worth]^ fellows, and like to prove tnoft fi<- 
newjr fwofd-tnen. [Exemm. 

s c E N E n. 

Enter the Kkg^ and Lafea. 

Laf. Pardon, my Lord, for me and for my ttdinga, 

Ki9^. I'll fee diee to ftand up. 

Z^. T%en her<f s a man ftands^ that halh bought 
his pardoni 
I would, you had kneel'd, my Lord, to asik me mercy ; 
And that at my bidding you could fo ftand up. . 

King. I would, I had ; fo I had brok^ thy pat^ 
And ^M tiiee mercy foi^t. 

Laf. Goodfaith, acrofs : — ^but, my^ood Lord, 
*tis thus ; 
Will you be curM of your infirmity? 

Xwjf . No. 

Ltff. O, will you eat no grapes, my royal fox? 
jjes, but you will, an if 
My royal fox could reach them : I have feen a me- 

dicine^ 
That* s able to breathe life into a (tone ; 
<>iicken a rock, and make you dance Canary 
With Iprightly fire and motbn ; whole fimple touch 
Is powerful to araife King Tepin, nay, . • 

To give great Cbarlemain ^ pen in*s hand^i 
And write to her a love-line. 

Gng. What her is this ? 

gahntry tha in v«guc» of ireviog jeweb* Atamm^ and tbelr 
Biiftids^t favours in their caps.-— f7rr« to rnufiir trut foii, fig- 
■ifies to aifembfe tegether in the high rood ot the faflnon. All 
the reft is ]ntelli{^ and eaiy. 

Laf. 



n 



30 AWs nvell, . that Ends 'well. 

Laf. Why, doAor*(he : my Lordi ihert's one v-. 
riv'd. 
If you will fee her. Now, by my faith and honour^ 
If lerioufly I may convey my thoughts 
In this my light deliverance, I have fpoke 
With one, that in her fex, ' her years, profeflion> * 
Wifdom and conftancy, hath amaz'd me more 
Than I dare blame my weaknefs : will you fee her. 
For that is her Demand, and know her bulinefs ? 
That done, laugh well at me, 

IGng. Now, good hufeuj 
Bring in the admiration, that we with thee 
May rpend our wonder too, or take off diiiie. 
By wond'ring how thou took*ft it. 

I^. Nay, . rU fit you, . 
And not be all day neither. \Exit Lafeu. 

4 JCf/r^. Thus he his fpeciai nothing ever prologues. 

Z.^. {Returns.^ Nay, come your ways. 

. . [5m^//g i» Helena. 

King. This hafte hath wings, indee^l. 

Z-tf/. Nay, come your ways. 
This is his Majefty, fay your mind to him ; 
A traitor you do look like; but fuch traitors 
His Majefty feldom fears ; Pm Crtjfid*^ uncle, 
That dare leave two together \ fare you wdl. \ExiU 

SCENE III. 

King. Now, fair One, do's your bufinefs folbw us ? 

HeU Ay, my good Lord. 
Gerard de Narbon was my father. 
In what he did profefs, well found. 

King. I knew him. 

HeL The rather will I fparc my praife toward him ; 
Knowing him, is enough : on's bed of death 

3 -^bir yearly t^ofejp§n,'\ By /Srg/r^ipa is meant her declaration 
of the end and porpofe of her coming. 

Many 



r 
« 



AlVs njjellj that Ends ^ell. 3 1 

Many receipts he gave me, chiefly one. 
Which as the dearcft ifTue of his pradice. 
And of his old experience th'only darling. 
He bade me ftore up, as a triple eye, 
Safer than mine oWn two : more dear I have (b \ 
And hearing your high Majefty is touched 
With that malignant caufe, wherein the honour 
Of my dear father's gift ftands chief in power, 
I cotoe to tender it, and my appliance. 
With all bound humblenefs. 

King. Wc thank you, maiden ; 
But may not be fo credulous of cure. 
When oiH* mod learned dodors leave us % and 
The congr^ted college have concluded. 
That labouring art can never ranfom nature 
From her unaidable eftate : we mud not 
So (lain our judgment, or corrupt our hope. 
To profticute our paft*cure malady 
To emp^Jckss or to diflever fo 
Our great ftlf and our credit, to efteem 
A kpfdcfs help, when help paft fenfe we deem. 

Hel. My duty then fliall pay me for my pains ; 
I will no more enforce mine office on you ; 
Humbly intreating from your royal thoughts 
A modeft one to bear me hack again* 

King. I cannot give thee lefs, to be call'd grateful 1 
Thou thought'ft to help me, and fuch thanks 1 give^ 
As one near death to tnofe that wi(h him livej 
But what at full I know, thou know'ft no part ; 
1 knowing all my peril, thou no art. 

HeL What I can do, can do no hurt to try. 
Since you iet up your reft 'gainft remedy. 
He that of greaceft works is finifher. 
Oft does them by the weakeft minifter: 
So holy writ in babes hath judgment fliown. 
When judges have been babes; great floods have ^ 
flown 

Frona 



3J ^^s iwtf, ^' Bat Bfe/jr laeUi 



From fimple fiiAm ; Md great Teas have diy^d^ 
Whcri^ir^dcs have by th' greaceft been dcny'd. 
Oft exfislktion hxis^ and tnoft oft there : 

Where tnoft it promifes : and oft it hits 
Wherchhi^ is coidcft, tind de^ir moftfits. 
IGng. I muft not hear thee; fare thee weil, kind 
Mhid ; . .- 

Thy pains, not us*d, muft by thyfelf t)6 |>atd : 
Proffers, not took, reap thanks for their teward, 

Heh Infpired merit fo by breath is banM : 
It is not fo with him that all things knows. 
As 'tis ynt\i us, that fquare our gads bf ftiows : 
But moft k is prefumption in us, when ^ 

The help of heaven we count the a£tof men. 
Dear Sir, to my endeavpnnr give conlent. 
Of heaven, not me, iftake an experiment. 
I am not an impoftor, that proclaim . / "' 

* Myfelf againft the level ot mine aim 5 
But Know I think, and dunk I know mclftfure, 
M)r art is not paft jpowcr, nor you paft cure. 

IQng. Art thou fo confident ? within what i|iace ^ 
Hc^ft thou my cure? 
. HeL The greateft gpice lending graces 
Ere twice the horfes of the fuA mall bring 
Their fiery torcher his diwnuil ringi 
Ere twibe in murk arid occidental damp 
Moift J9^^«^j hath quench'd his fleepy lamp j 
Or . four and twenty times the f>ilot's glais 
l&tb «kl the thievifli minutes 4iow thev pafs*; ' "^ 

What is infirm fix)m yqur found parts mall fly, '^' 
Health (hall live free, and ficknefs freely die. - 

King* Upon thy cerui^ty and confidence, ^ 

What darHl thou venture? ' { 

HeL ' Tax of impudetice, * 

4 Myfiffogainfi the le*t^l of mine aim ;] /« e. pt^tead to gcr^rr 
things Chan befits the mediocrity of xny condition. 



i 



jtlU's 'wetl, that Bmds *mtt, J 5 

A ftrumpefs boldncfs, a divulged fha^ne * 
lYaduc'd by odious ballads : my maiden's name 
Scared ocherwife, no worfe of worft c:ittcnded| 
With vilcft torture let my life be ended. 

King. ^ Methinks, in chee fomc bleilcd Spiru dioik 
fpcak : 
His power full founds within an organ weak % 
And what inipoflibility would flay 
In common fcnfe, ienfe faves another way. 
Thy life ]s deaf ; fof all that life can race 
Worth name of life, in thee hath dftimatc; 
* Youth, Jxauty, wHdom, courage, virtue, all 
That happinefs and prime can happy call ; 
Thou this to hazard, needs muft intimactf ' 
Skill infinite, of monflrous defperate. 
Swat Pradifer, thy phyfick 1 will try ; 
That minifters^hine oWn deaths if I dief. 

HeL If I break time, of flinch In property 
Of what I fooke, unpitied let me die, . 
And well deferv'd ! Not helping, death's my fed i 
But if I heip^ what do you promife me f 

Hu powvrfol foond, wthin tm •nM 'nu9mk\^ ^9 J^uA. 4 
fimul is a barbarifm: For /# AMi figmfies to Btttr an artitmkti 
kuAf L €. a vaioe. So ^haLjf$mr^ in Umii Labtmr l»A^ fayt 
licb proprittjri jiwd tubtm kvt ijpeaks thi Yokm 9f M tie Gmb. 
To^ai a JoumJ therdbre is isrproper. tko* to tastr ^fomti it noC | 
hecaaic cbe woid wmr may be applmctdier to aoafticiikfieor mm* 
licalaicu Befidea, tlie ooa^uAkNi is vioow wich the two abladvttp 

tjtifey, and, m/ithim mm mjmrn wiok. The linat tberafiKt Ihoidd ki 
dutt nad and poinied, 

Mitbinh^in tbetfimi hlejfei ffirit 4otbJfimi: 
Hts p9*wir faiXfmnds mjUbin ak drgam WCkJc . 
. Bat AgiCxftril Editor would be onH (o & beholden to this enieft* 
I dttni, as to enable him to make (enfe of th^ lines another wzf^ 
wkuevcf become of the rules of critkifm o^ ingenudos dealing. 
It pe/wirful fiunds witbia am orgam niHai. 

* 6 nmti, Sismh, mfifJmf ewrage, all] The verfe WMrtl a fiMt 
?UT VI, hj mifchance, has diopc out ot ()ke tarn. 

Vol. IIL P ISf^^ 



» - 

$4 ii^*^ '^^h that Ends ^ff, 

JCf/wf. 7 Make thy demand. 
HeTf But' will you malcc it even? ' ' 
King. Ay, by my (cepter, and my hopes of hcavcnr, 
HeJ. Theu (halt thou give me, wich thy kingly hand. 
What Husband in thy power I will qdooroand. 
Exempted be from me the arrogance 
TQt:ch\i& from focth the royal bk)od of Franffi *» 
My low and humUe name to propagate ' 
? With any branch or impage of thy Date : 
hvit (\KAk a one thy vaflaU whom I know 
Jb. fpcQ^ j6r me to a$k, thee to beftow. 

jKsf^. Here is my band^ the premifet obfervM, 
Thy will t^ my performance inall be (crv*d : 
JBOf make the cnoioe of thine 09fn tune) for I^ 
rThy rcfolv'd Patient^ on- thee ftiH rrfy* 
,More Oiodld I queftlon thee, and mote I moft; 
;(Tho^ more to know^ could not be OH^c'iacruftO 
From whence thou cam% bow tendad orii^-^biit icft 
Uoqteftion'd welcome, and undoubcied bleft. 
Give me fome help here, hoa! if thou proceed 
: As high as Word, my deed Ihall fliatoh &y deed/ 

^ f Vinp Make thf dfmtmd. - 

King. Jy^ bf wf fctfitr imd fsy hfp$, tf bdp.l Tht^Kit/g 
.OonH^vt b«t a very ilig^ hope of heif hoA .Hec^. Jcirceciumgh 
:co Unucfhyi and thMtbre H$Un might TdTped he meant io 
- ^^otMs with ber. Befixki,' obferve, ' the <mmk part of tile 
•icene it Ari^jr in rhyjtte, and dhaieit ii»<lha2ow of reafen-wlqr 
*k ihoiild be internifecd^herei ^I>«adier imagine the poet mtmsi^ > 

4f» h ^fi^*^* ^. m hP^^ ^f ^ven. Dr. 1KMr%. 




or facker : by which Oie means one of the ions of f 
^ Cat/mi calb our Prince i^/^ar^ ^hat toih l MPs tffmi 



,. t s# * * 



\<'\i-^ -SCENE 



AU-fweii- thai Bkdsio^i f^ 

S C , E ■ t<?' ■ fe -JiV.n ' ■* ' 

' ^. '0^P£^^ to Roufillon. 

Enter Counteh and Clown. 



Ccunt. ^OM£ ita» Sir; I ftail Mw.put Drott to 

C/9. I nil ibc¥rc nqriUf i%Wy 6d,. and kMr^ 
taught ; i kooflUFi izi]r b\3&ai^%^JM^ tp i»he epuit. 

C(7i^ii/. But tor the.^fiuit! wiifi iKrhar place waSm 
% youipedal^- shcn.Too pvt off ibac wirh !iucb con* 
^ tempt \ bat td ehe courtl 

0(?* Tmfy^.LMadnir if God We lent a man 
any manners^ str asay ^afily f uc k x)(F at coiirt: lie 
that cannoc tmkt a 1^, put aff's cap, kiis hb haodt 
and :fiqr.iicttbiagi kaaioQicbcr leg^.bmds^ U^, nor i:at> ; 
and^ inckcdv fitch a fallow, to fay precifcly^ wens oot 
for the £titito: jbiif:6ir ae, iitme ao anfw<r wiU iitfve 

Cflnat J»u]oy^rthai^a.a.'jboiintiful Mfittr thatt £ts 
iH oueftioiis. 

Gi?. It is like a baiiier's cbair^^ that fttaaIl«faQttpcks| 
the pin-buttodc^ the qiwtch-butcock^ .the brawf^ 
•battock, or «nf buttock. ' 

' i^9(oit, Wlll.yosir anfve;^ fenre & to, all qu^ipna? 
M C^. Aa £t as ten groao is for the hand of an aiOMra 
aty^ at.yoHB Fumb craaoi 6x foor tfdfoy punk, aa 
T&9 rolh for Tonf^ fQte»&iger, aa a pancake kt 
ibrvve^Tuefday^ a mottis fbf Mdy^ii^^ as the oail to 
llis^hofe, the cuckold tx> fait horn^ ad a fcoiding quean 
lb a wrangling knaire^ as the nim's lip io the ii^iarfk 
mouths our, as^ the pudding to hU akio^ 

C^iT)!/. Have you, I fay, an anfwer of foch Bfiaeft 
for all qucftions ? 

Ch. From below your dtike, to beneath your 
conftable, it will fit any qucftioo. 

Da Cwnt^ 



36 dtt*s ^elty that Ends niiell 

Count* Ic muft be an anfwer of moft monftrous fizc^ 
that mud fie all demands. 

Ch^. But a trifle neither, in good fitith^ if the learned 
fhould fpeak truth of it : here it is, and all that be- 
longs to*t. Ask me, if I am a courtier | it fliall 

do you no harm to learn. 

Count. To be young again, if we could : I will 
be a fool in a queftion, hoping to be the wifer by 
j^ur anfwer. I pray you. Sir, arc you a courtier ? 

Clo. 9 o lord^ Sir — — there's a Ample putting off: 
more, more, a hundred of them. 

QPHHt^i^)^\ 1 ^^ a poor friend of yours, that loves 

yy^i Q./ott^^ iSiV-r^ thick, thick, Ipare hot fhe. 
> .Co^.v I think. Sir,, you can eat none of this homcTy 
flieaM' ^ 

Clo. lord J 5*ir-T— nay, put me jto*t, I warrant 

you* T 

Count. You were lately whip*d. Sir, >s I thmk. 

Clo. O lord J 4S/r'— — ipare not me. 

Count.. Do you cry, O Jood, Sir, a( your whipping, 
and fpare not me ? indeed, your O lord, Sir, is very 
fequeot to your whipping: you would anfwer very 
weJi to a whipping, if you were bi^ bound to^t. 

Clo. I ne'er had worfe luck in my life, in my— O 
lord, Sir ; I fee, thji^ xhay fervc long, but not tarvc 
ever. 

Count. I play the noble bufwife with the dme, to 
entertain it fo merrily with a fool. 

Clo. O krdy Sir — why, tha^'t fervea well again. 

. Count . An end. Sir ; to your bufineis : give Helen this. 

And urge her to a prefent anfwer back. 

Commend me to my kinfmen, and my ion : 1 

This is not much. '^ ' 

* 9 Obrd. Sir, ] A ridicule 00 tfaat ipdliib expletive of Ipeech 
dien in vogoe au court. 



All'j nvell, that Ends nvell 37 

Qo. Not much commendation to tbem ? 
Cwnt. Not much imployment for you, you un« 
dcrftand me,, 
Clo. Moft ffuitfullvj I am there before mylegj. 
Cmnt. Hifte you'agafrf. {Exeunt, 

SCENE V. 

Cboftges to. the Court of France. 

Enter Bertram, Lafeu, and ParoIIes. 

L^. 'T^ H £ If fay, miracles are paft> and Vf have 
X QUf. philofophicaj perfons to mAfi modern, 
ttd&miliar,. things fupeniatural and cauielefs. Henoe 
IS it, that we maKe trifles 6f terrors ; enfconfilig our 
iebes ipCD foeming knowledge, when we Ihould fob* 
mit our felves to an ' unknown ftah 

Par. Why, 'tis the rareft argument of wodder 
that hath ffiot out in our later times. 

£er. Andb 'tis. 
. . Laf^ To be; rdinquilh*d oF the artifts-*— -• 

* Par. So X fay, both of Gakn and Paraceljus. 
* £^. Of all. the learned and authentick Fellows—* 
( ._P^r. Righj; fo I fay. 
1 Zi//Th^"'givie him out incurable. 

Par. Why, there 'tis, fo fay I too. 

1 wtkmwnfeari] UnhtWM br fup^roatunU. 

X ?m ^^ lf*9f M / Galen andf^ncpUas. 
liif. 0/ ail tb€ learned and authentick ftUowi. j Sbaks- 
J^ar^ aJi 1 have often obferved, never throws out his woitis at 
nndom. Faractlfmu tho' no better thin an ignorant aad kaavifc 
cnihofiaft sal at dtisiixue in i^ch vogae^ even amoogft th^ learned^ 
that Jie bad almoft joftled Gakn and the ancients ^t of credit. 
On this account UarmU is applied to GaUnx and atttbeniick er 
&fluanfble to Paracelfus. Sancy^ in his Confe/pon Catholiqui^ 
p. jo^. Ei. cSA 1720, is made to fty, y* tronwU khfitrtfrt' 
mtr MuUcsMg it wuilUure bumemr qui c$i ghU'la. iljtfi bw Ga^ 

D 3 knifte. 



'^? 



M'f V9^, thin Bdt ^n.. 



l^af. Net to be hclp*d» -— -— ^ 

IPar. Right,' as 'were ^ man afliirM of an ■ ■ » ■ * 

/^/. Uncertain life, and fure deaths 

far. Ttifty yoii iaf well : fo wocAd I Bave faid. 
« f^afi^ t may truly fay^ s is a noveky mche wofld. 

Par. It is, indeed, if you will ha^ ic an ihewiag^ 
you fliall read it in, what do you call there 



^n^ 



Laf\ } A Jbsvifing of a beav^tdy effi& 0i an eartbfy 
4&or. 

Par, That's it, I would have faid the very iame. 

Laf. Why, your dolphin is not luftier t ibr me, I 
ipeakJn rcfpedl—- »« 

J^4r, ^ay,, 'tis ilmige, 'tis rery Atfange, that is 
ihe^briff *M«1 the tedious of it » and he's of 4 oioft far 
Itinerious fj^ii^ that will soc acknowledge it co be 
the > ><* » ■■■■ •» - • 

JL^/. Very hand of l^av^m 
Par. Ay, fo I fay. » 

In a moft weak ^^-^ 



Pap. And debile mimfter, grett poww, great traiih 

(cendence^ ^ which ihould, indeed^ give us * * * % 
farther ufe toi>e ma^d^^ban alone the racovVy of the 

Iting^ as to beipv<4^m«>> . . 

fcni(te, (f iris Uh Paracelfitte. // iU que fa Jo^rine di Oalien 
0ttSkoMit, 6* «02r mtfffijuhU four la patlHogie^ if profitabU 
four Us B^fpan. VhMta^' fon^osu fui 4i/oit ^ ^rmis frtnfta 
A i^aiacal&, ift bonne a fiiivre poar ia v^he, poor la liib ' ' 
pour IVipaigne; en fomme pour la Therapcutiqae, 




1 Apinmng 9f a Uwv^nhf tffcB, &c ] Tlie title of fottie pam- 
phlet htie Hdjcaleds*' . r^ - - 

; 4 %^i>A fiouU, indttdi^ghpt its a farther ufi to ht tnAiu &C.] 
Bc^)^^ t))e. Words us and 'afartbtr, thtrt ttema to have hctn 
tv^6 6t ihnb words droplb» which appear CO have been to thia 
parpofe— ^ifA/, iudegd, give us [notice, that there is of this, J a 
fttrtbif^a/^fbirmadi^'i^ ib that the ped&g^ ihoold be read widi 
$aiuit^tgw the f^Mit. 

^ S C E N fe 



^i nodl^ tim Bmdi lonlll 39 



t 



. -£ -C E N U' VI. : .-\ 

Enter l&$^j Helena, atut jfttendnna. ^ 
P4tt. I would have laid it, you faid wellrlieiy 



the Klnft. 

jL^. Luftkk, as the Dutdman fays: TlMike ^ 
Maid the bettelfy while I have a. tooth in qay he^d: 
why, he*s able to lead her a Corranto. , ^ 

Par. Mort duVinaigri! kttotM& Helen t 

Laf. Tore God, I think fo. 

Kit^. Go, call before me all the Lords in'coOffc • 
Sit, my prefervcr, by thy patient's fidej - ^'\^ 
And with this healthful hand, whofe bonifiiM finfe- 
Thoo haft repeal^], a fccond time receive. '- 
The confirmation of my promised gift ; V'^ ^ - ; 
Wiiich but attends thy naming. ;- 

Enter three orjqur t^rii. " ^ ; * 

Fair maid,i!»d forth thine eyei this yoixth/bl j^itel 
Of nobJe batcbelors ftand at f»y beftowing, * | 
<yer whom both fbv^reign power and father's voicCj 
I have to ufe*, thy frank eledtion make^ ; ^ -^ 
Thou haft power to chufc) and they none to folrfiike* . 

Hel. To each of you one fair and yirtuouarniftr^A 
Fall, when love.pleafc! oiany, to each Imt j^^wrrt? 

Laf. Pd give bay curtal and his furmeuce, - 
My nuMitb no more were broken than tbefe btfys^ ; 
And writ as little beard 

Kn^. Perufe them well : ^ ^^ n e . 

Not one of thofe, but had a noble father. ' • . ., 

{She addtrffes berfelf to a Uri. 

Hd. Gentlemen, heaven hath, through me, nftbr'd 
The King to health. 

jtU. Wc urtderftand it, ^d thank heaven for yeuu 

Heh I am a (imple maid, and therein wealthieft, 
That» I proteft, I fimply am a maid.- ■ ■* 

D 4 Pleafc 



?e9fo itryour^ MajeftiTt. I have dooralniiuiy : "' ^ 
hcblulhcs in my clerics thus whifper me, "T 

We blufb that thou ffaoubd'fircbuie, bur^^e rftfiisMf 
9 Let the white death iit on thy check -f&t ever, 
Wc!lLuc!cr come thvtc again. ' 

ISng. Make choice^ tsd iee, 
Whqfliuosthylovct fliunsall hisloreinme. 
' Hel. Now, jWiJfr, from thy altar do I Uy, 
* And to irppartial itrtv, that God moft high, * 
Po my 6ghs ftrcam : Sir» will yog hear my fuit ? 

1 Lord., And grant it. 

Hel. Thanks, Sir;'~-all the reft is. mute. 

L^. I had rather be in this choice, than throw 
nmesrace for my life. 

Hei. The honour. Sir, that flames in your fair cycs^ 
Before I fpeak, too* threatningly replies! 
Love make your fortunes twenty times above 
Her that fo wifhes, and her humble love i 

2 l^d, No better, if you pleafe* 
Hel. My wifti receive, 

Which great Love grant ! and ib I take my leave. 

Zjf* Do all they deny her? if they were fong of 
mine, I'd have them whipt, or 1 would fend them 
tf) the Turk to make eunuchs of. 

Heh Be not afraid that I your hand fhould take, 
Ml never do you wrong for your own fake : 
Plc0ing« upon your vows, and in your bed ' 
find fairer fortune, i^ you ever wed ! 

Z/ff. Theft boys are boys of kcy tbey^ll none of 
her : fure, they are baftards to the En^ifb^ the French 
n^cr got 'cin. 



C Lii thi white DZ at njli Mr tfr^ cheek for ever,'] ShaJU^st^ 
1 think, wrote db arth ; i. e. want of bloody or more figuf^ 
tively barrenodfl, want 6f£Mt or ifTue. ^ 

6 JuJ to iMi^tkiAL Love,] The old editloM ' reacf imi*ar« 
T I A L, which is right Love who has no regaixi to diflereqce of 
pondtttOD, but jrok^ tog^ditr higii and )ow» whfch was iuer ca(^. 

HeL 



ffel Yoa ^ too yoong; t6o,happy ^'and Yott ftbocfx 
To make yourfclf a fon out of my blood; ^' ^ 
4l^i. Fakonc, I think not fo, ' -^: r ' • 
7 1^. There's one grape yct^*— * - ; \ ' 
Par. 1 am fare, thy ftther^b^unk wine.' '" ■ ' ■ ■■ ^ ' "^ 
£4^. But if thou bereft not an afi, I am a ^ \ ^ 
Youth of foufteen. I have known thoe ahrtatfy. 

Hel. I date itot fay, I take you ; but I give 
Me and pay fcnrice, ever whitft I live, 
Into your guided power: this is the man. 

pi Bertram. 
IBng. Yfhy thtn -, young Beriram^ take ber^ fhe^a 

thy wife. 
Ber. My wife, my Liege ? I Ihall beftcch yottf 
Hi^nefs, 
In fuch a bufmefii give me leave to ule 
The help tA mine own eyes. * 

IRng* Know"ft thou not, Birtram^ ' l - - 

What (he hath done for me? . ^^' \ ; 

' Ber. Yes, my good Lord^ '^ '"*-. , ., 

Butivever -hope to know why I fliould manylier. '[ 
^ng. Tfaoa know'ft. Die bas raisM me lipni my 
fickly bed. - ^ 

Ber. But follows it, my L6id, to bring me down 
Moil anfwer for your railing ^ I know her welh- * 
She had her breeding at my father's charge : ' 
A poor phyfician's daughter ffly wife! — DifSain 
Rather corrupt me ever 1 , * 

*' King. 'Tis only tkle thou difdain'ft in her, the Which 
I can build up : ftrange is it, that our bloods, ' ^ * 
Of colour, weight, and heat, pour'd all together^ 
Would quite confound diftinftion, yet ftand off . 
In differences, fo mighty. If ihe be . ' 

AH that Is virtuous (fave what thou diflik'fb 
A poor phyfictan's daughter,) thou diflik'ft 

7 ThiTi^i otfi frapt jrfA— ^3 I havc httc r^gphtcd die ipeechet 
*» thejr ought to be. 

Of 



Of vjrqi»for the oams: hut daooefo^. . ^ " 

From loweft place (a) wheni vimious^ching^ ppoieed^ ; 

The plsoQ is digni^'d by th' doer's dosdv 

Where great addicion fivells^ and' vimie oine^ 

Ic is a dropGed honour ^ ' good alone . 

Is good r and, with a mme, vileods U ib : ^ 

The picf)erty by what it is Ihould ^ 

Not by the dtlc. ^ She is^pxxl, wiie, Mr ;' 

In thefe, to nature flic's immediate heir ; 

And tbefe breed honour : That is honoor*s (corn^ 

W hidi challenges itfelf as honour's bom^ 

...'-' And 

' .-.l /# £99^ mtiibomt a nam$. Vilnufi it fiij: Tbs tmt u here 

comipted into nonfenfe. We (hoald xead 

— ^-^^ ■ goo J aioM 

Isgdodi at^f tMfitb a namt^ wknift iifi, 
L $, g^ ift good, the* there be no addition of titles aad vHeneft 
is ▼ilenefs, tho* there be* The O^^i Editor* vodcrfiandips' no^ 
thing of this, ftrikes bat n;ihnefe and puts inXH pUoe, f**{/^^ 
^ . , ^ . . Shi is YOuuG, wfitfairi .. 

Im ihoji, to nsturt J^o]i imrnoMati heir ; 

Atitie/iirMtthnmr; 1 The o(y|edio8^«nB» ibktfUlem 

ksd odthtr riches nor titfe : To tbii the Kiiig veftks, flieV /A# 
ihunediate heir of natms, fipqi whom (he inberitf yi»itl|^ wifdoniy 
and beinty. The (honght ii fine. For fajr the ifkmidiMte heir to 
asmrey #e mail underftand one who inherits wiicCom and beautjr 
in a fttpreme degree:. From hence it appear? that jtfStf is a ftultf 
leading, for that does not^ like wifdom and beaaty, admit of dif- 
ferent degredi of excellence i therefore (he could ii6t, with regard 
CO thaff be feid to be the imme^flate heir of natint j for in that fhe 
wa5 only jotnt-heir with all the reft of her fpeciM. Befidet, tho^^ 
wi/Jom aiid kemittf may hretJ homut^ yet yotoh cannot be fkid to 
do fo. On the contrary, it is i^e which has this advantage. It 
feems probable that (bme fboliDi player when he tranfcribed this 
part, not apprehending the thought, and wondriDg to find youth 
sot reckoned amonglt the good qualities of a Woman when fhe 
was proposed to a lordy anQ not confidering that it was comprifed 
in the wordjmrt fbifted in^otngf, to the exdnlton of a word much 
more to (he purpofe. For I make no qoeftion but Shahjpiti^ 
wrote» 

— Sbi is GOOD* ^'tfitfaiu^ .^ ^ 

for 

[ (tf) — — ^htn^ Dr. Thirlby — volg. ivhttue'} 



M'^ ^fkffi lim Bids^eB> 

And is not likethe.fiK;. HononcrbBft thrive^ * 

Wfaea mther from cmr a6b we them derive 

Than our fore^goers: the mete ward's a flave 

Dcbaucbt 011 every tomb^ on ev^ry grave % 

A lybg trophy i ^ and as oft k dumbt 

Where doft abd duan'd oUivkm it the tomb 

Of honoured bones, indeed. What (hould be iaid } 

If thou can'ft like this creature as a maul, 

I can create the reft : virtue and flie. 

Is her own dow'r 1 honour and.wealth from me. 

Ber. I cannot lov« her, nor will ftrive to do^t. 

J&^. Thou wrong*ft tbyielfy if thou (hould^ft ftrive 
to chufe* 

Hsl. That you are well rcftor'd, my k)rd, Pm glad< 
Let the reft go. ■ ' » — 

King. My honour's at theftake ^ which to (a) defend, 
I moft produce sny power. Here^ take her hand» 
Fkood icomfol boy, unworthy th» good £^l 
That doth in vile miipniion fhackle up 
My love, and her delert ; that canft not dream» 
We» pokmgm. ia her defeftive fcale. 
Shall weigh 4h9e to the beam ; that wilt not knoWt 
k is in OS CO plane ditne honour, where 
We picafe to have k grow. Check Ay contempt : 
Obey our will, which travels in thy good ; 

For the g^eateft part of her encomium tamed apoa her virtae. To 
omit tbi» cbeitrfore in the recapitulatum of her qutlities, had been 
againft all the riilet of good fpeaking. Nor let it be objected that 
this it reqoinQg. an exa^efs in oar aothor which we ihoold not 
expert. For he who could r^fon with the force oar author doth 
hire* (and we ought always to diftjogaifli between $bah/f$Mr on 
his guard and in his rambles) and Hmftrate that reaibning with 
iiich beaaty of thought and propriety of eapieflioa, could never 
Mike tt(e of a word which quite deftroyed the exafinefs of hit 
neafoning, the pr<^icty of his thoaght, and the elegjittce of his 
CxpreAon. 
1 Commas and points here fet exadly right by Mr. ni$iaU* 



H 



[ («) ...^ difind, Mr. ThtciMd -— vulg. di/uU.^ 



Believe 



^ 44 /4//V nveif, ti)at Ends nvett.^ 

Bcliew?iot thy difiJaiif, but prefently ^ 

Do chine own fortunes that obedient right, 
Whidh'li6tb thy duty^tves, and our^power claimii 
Or I, wilJ thro\ir thee Ifem my eafc fdr-evcT * 
iiitb^fhe ftaggers, and the careliTs kp)fe 
Qf youth and ignorancfe^ my I'W^nge^nd hate * 
l.T)ofin^ upon thee m the namc'oT juftice, 
.Without all terms of pity. Speak, thine oDfwer. 

Ber. Pardon, my gracious Lord s for I fubmic ^ 
My iVncy to your eyes. When I C(>ofider, 
What great creation, and what dole of honour 
l^ife^ where you bid ; I find, that (h^;whiah late • 
Was in my nobler thoughts moft bafe^ -is now 
^The'prifed of the Kmg; who, ib enoUed^ 
Is, as/twere, born lb. 
* King. Take her by the hand. 
And tell her^ (he is thine: to whom 1 pramife 
A counterpoize v if not in thy eftate,^ ^ 
A balance more repleat. 

Ber/'l take her hand. 

King. Good forftine aodthe favo^nof the Kiog ■ 
Smfleupon this contra6l^ whole eereffioMy. 
Shali feem expedieht oh ihe new*bo#n'6irie/, ' 
And be performed to night ; the (olenih feilt 
ShaH more -attend upon t&e coming ^£e, 
j^xpeding abfcnt friends. As thou lov'fHwr,- 
Thy love's to merdigious; elfe does err. [fLxtunL 



•♦ w 



S C E.'N E VII. 

Laf. Bo you hear, Monfieur I a woni widi yoo. 
Par. Tour pleafure. Sir .^ " - 

2 7hi V tLAi 8 ED o/ ihi Kifig'fj We (hould read FitrtEDi iT*^ 
valued, held in eftimacian^aiulanUyeK to n^^^JAtbe ptfopding 
line. " • . 

La/. 



J 



Laf. Your L^rd and . Mailer did well to^ j;n^ his 
recantation, • 

Pur: RceanQuioD? aiyXord? my IVJaftcr? 

Laf. Afi 16 «c not a langMage Ifpc^k?. 

Par. A rooft barlhooe, god not co be undqrHood 
witboix ^bloody iuGCMdiofti My m^ifter? 

Laf. Are yoo compaiiuon to the Couoc Rot^ll^n f 

Par. Xaany Copnc \ tp all Counts. ; to wiiac is 
I iDan» 

Laf. To wihat is Count's man \ Count's mailer it 
of another Alia 

Par. You are too old^ Sir \ let it latisfie you, yoti^ 
arctoaoW-*— 

Laf. I oMft teU tbee, SirnilH I write rnaua cq 
whicn title age cannot bring thee« 

Par. What I dare loo well do^ I dare not do. 

Laf. I did think thee, for two ordinaries, to be a 
pretty wife fellows thou didft make tolerable vent of 
thy travel ; it might pafs ; yet xbe fcads and the baor 
oerets about thee did manifoldly difluade me from be-r 
lieving tbceaVvciflfl of too great a burthen. I havqi 
DOW found ^Siisi^s • ^hen I Jofe thee ag^in, I cafe^upt : 
yet art thou g$od. for xxKhiog but taking up» and chat 
thou*rt fcv^ worth. . . 

Par. Hac^tbou not the privilege of antiquity upon 
thee " ■■- 



/. Do riot plunge thyfelf too far in anger^ kft 
thou haften thy tryal; which if, ■ Lord have 

mercy on thee for a hca 1 fo, my good window of 
lattice, Are thee well ; thy cafement I need not open, 
I look thro* thee. Give me thy band. 

Ban. J^ Lord, you give me mod egregious in- 
dignity.' 

Laf Af, with all my heart, and thou art wbnhy 

V T have not, my Lord, deferv*d it. 



*j \ 



Laf 



46 ^//V nveUi that Ends nvilt, 

Laf. Yes, good faith, evVy dram of it ; and I will 
not bate thee a fcruple. 

Par. Well, I Ihafl be wrfcr-^^ i. 

La/. Ev'n as (bon as thou can'ft^ for thou haft to 
puH at a imack o'th' contrary: If ever thou becft 
bound in thy fcarf and beaten, "^ou fiiait find what 
it is to be proud of thy bondage. I have a defire td 
hold tny acouaintance with thee, or rather ray know- 
ledge, that I may fay in the defauk, he Is a pah I 
know. 

Par. My Lord, you do me moflf infupportable 
Texation. 

Laf. I would, it were hell-jpains for thy fake, and 
toy pbor doing etemri : 'fer doing, Itttip^*,*** 
as I will by thee, in what modon age will give mt 
leave. • - TExii. 

Par. ♦ Well, thou haft a fon BraH tal^c tha dif- 
gracet>ff me-, fcurvy, old, filthy, fconryljord! 



•-■*i 



well, I inuft be patient, there is no fettering of au^ 
diority. Pfl beat him, by my life, if I ean meet him 
wkh any convenience, ao he were double and double 
a Lord: ^ PH have no more pity of hi^ kge, than t 
wouH liave of — Vn beat him, an if I could But 
meet him again. 

, Z^fir d$ing I am pafti as I will bf iba, in njoiai auiitm^H 
mfiiiglvi mi li4tvi,'\ Her^ isa line Joft after faftj fo cfa^t k ihould 
be diftio|;ttl{hed by a break with aflefisks^ The verj words Qt 
the loft Tine it'is impoflible to retrieTC^ but the fenfe ur lobnous 
tnoac^ F§r*deing I^am fafti age has deprived me of xiluch of 
TKf Smx aad vi^ur» yet I tetve ^lLea<li^h 10 fliew the w«rid I 
can do my&if riehc, as Lavii/ In tbttt in 'wbai.nmtifia for in ^ 
nMMMiepJ age ivnl gttrf me Uatfe. 

4 Well, tb9n ball a fimjbatt take ibis^di^acii^'mii^ Thui die 
poet iftalbts farJks fpeak alone^ and this i» UMiUv^ Atowaud 
would try 19 hide luspokiooafy evpi fiom itiaiMCA>i^^^<jordt'* 
oary writer would haye been glad of fiich «a^«f|miHaity tpJM'iiC 
hiia tb dobftfliai. 



• 4 » 



K T' 



Rh 



Aits 'OitUi f^f £»/' 'oxV. 4f 

'" Re-enur Lafcu. 



Jjtf. Sirrah, your Lord and Mafter's married, thcK's 
news for you : yon have a ticvf miftnde. 

Par. I moil uhfeignedly befecch your Lordlhip to 
inake ibme refervation of your vrrong». He, mf 
good Lord,' wh<uii I ferve abov^ i» my mailer* 

X^. Who? God? 

Par. Ay, Sir. 

£/^, The devil it is^ chat's thy mafter. Why dolt 
thou garter up thy arms o* this &i(bion? <k>ft mak^ 
hole of thy fleeves ? do other (ervants k? thou mat 
beft fee thy loiw jxirt where thy nofe Randsr B^ 
aiine honour^ if I were but two hours yaun^, VA 
beat thee : mcthinks thou art a gei^al offence, jMidi 
every man (hould beat tfaoe. t think, thou waft created 
for men to breathe themfelves upon thee. 

Par. This is hard ittld unddfemd tneafiice, mjf 

Lord. , - : r ' 

L^* GotOtSJrs you weM beaten in //ff^ ibr pidi^ 
mg a kernel <>ut of a pomegranate; you are a va^ 
bond, and no true traveller : you are niore iawcy with 
IcMrds add honourable perfenages, than the heraldry of 
yocu* birth and virtue gives you comcniHkm. 'You are not 
worth another word, elfe Td call you knave. I leavt 
you* - . . • ^. -fawl, 

• • • • . ♦ ' ; • . 

SCENE vnt 

JZflHtfr Bertram* 

Par. Good, very good, it is fo then.-— Good, very 
^good, let it. he conceard a while. 
. . JSer. IJndbne, and forfeited to cares for ever! 
- Par. Wh»t is the matter, fweet heart ? 
'-^ Bir: Although- before tfae^blemn Frieft 1 Ve Qf Qro» 
I will not bed hen 

P^ir. What? what, fweet heart? 
\K Btr. 



4^ AWi vuSi ska Eaub mall. 

Ber. O my Parottes^ they have married me: 
ril CO the ^ufcan wurs^ and never bed her. 

' Par. France is a dog-hole^ and it no CEiore mericf 
the tread of a man^s foot : to th* wars. 

Bir. There's lecffr^ iipqa my naotberi what the 
imfGfft St I know vsn yet. . 

Par^ hf% that wflnid be.k^own.: to lb* wan, my 
bpyi^^W th* wars. 

He wears his honour in a box, utlieoo^ 
That hggs his kickfyrwickfy here at hfliMi 
Speix]iog his maoly marrow in her arm, 
Wj^ftchc^oqJd fufidija tbe •houod and h^ curvec 
Of MarfH fiery deed : to other regions 
France is a fiahle, we ths^ 4wcU ta't jaiibi, 
Theqp&retoth'wart. . . 

fyr. It Ml be io, I'll find hor to my hwfe» 
Aoquaint my nx>tber with coy bate toiler,.. . 
AxA wherefore I am fled ; write to the King 
That which I durft not fpeak. His prdent gift 
Shall furnilh me to thofe Ik^n fieUk, ^ 
Where noble fellows flnke* War is no ftrifb 
To the dark houfe, and the detefted wife. 

Par^ Will this cs^ricio liokl io daec, arU fure? 

Bar. Go wisk me^to my chambos ^nd adrilb aie^ 
Y\\ (end her ftraight away : to-morrow - > 
I'lltothc wars, me to her fii^le ibrrow. 

Par. Why, thefe balls bomid, tkerefaiMMfe in ic.-— 
•Tishardi 
A yooi^ oian, married, is a man that's marr'd : 
Therefore away, and Jeave her bcavcly ; go, 
The King hath done you wrong : bat, hiiih J *tiaib* 

{Exeimk 



\ • 



■to « « 



SCENE 



S' "••« '''.£.' N E. • IX. 

i£«/^ Hde^a W dawn. 

•H</. My oiottler greets me kindly, is (he well? 

Cfo. She is not 1M}1» but y|et Hie 'b^« h^ heskh i 
fliW yery ' BW BT yy Ixat y#t fte i^ not wdi ; bur^cfcimki 
be ff^tny ike's very well, and \f antsodtking i*th' iToiM i 
bat yet &e tt MT w^ 

/£;/. If A»^ wry ^H, Whtf doe^ ihe ait, (bae 
flic's not vet7 iRit ? 

C/(^. T^y, fhd% viry vMjtli kdeed^ bat for tw(^ 

M. WliaMV^fhing^? 

C^. One, tittt tbifs n6t in beA^% wKitlitr Gckl 
iiakd brr^fsMlSy I tte oCher, that ike^s m earth, ftom 
whence God-iftiA^fair qiiMcly f 

^ /. £;r/^r JParoUcs, 

Ptfr. Bleft yfxiy oiy fectonite Udy ! 

Jici^ hboffy. Sir ^bsart. your jgaod will trliave 
mine owagMdiottone. 

PM^ky¥»ttitAmj>fnfmM t^iooitfaBm on i oihI to 
ke^tteoM^Of ^f^JiVBa fttlL . O^. ny knasire, iui^ 
docs my old lady i . ^ 

Clo. SothacyteiadfasrwnnkktaniiliiermBny, 

Pifr. Why^ t (ay nothing. 

do. MMry^ you :arei the v^ifer tmn » fot nuiy a- 
oaa'a toopr ' ftsalu out Jiis. mafter's undoing : to 
6yjiQiibfin|B».ia daaotl^tugy.t^i^ioir ooclBng,.aad ta 
JMUi^ng, is to be a great port of your title \ whidi 
is witbin a very little of nothing. 

Par. Away, diocf rt a knave. 

5 BUA1LU9 0tuJUimsJler*suMdt$i^:J WefhouMraul tFBAaa 
mi. This is to pr^tre ot Su ParolUit dif^raiQe. 

3V4ii HI.: E Ch. 



.51> M's noiU,.^ Badt *a>S. 

Clo. Yot] fhouid have.faid. Sir, before a knave* 
th'art a knavc ■, that's, before me th*an a knave : 
this had been truth, ;Sir. . > 

Pur. Go to, thou art a witty fooL.I have found 

thee."" ' 

Clo, Did you find me in youtftdf, SirJ or Were 
youteugtit to fi/id mci the fearch. Sir,, was profitable, 
and mtich fool may you Bnd in yOU,';e^n to' the 
world's pleafure, and the cncrcafe. of laughter. . 

Paf. A good knave, i''faith, and well fed, 
.Madam, my Lord wjl) go away to n^fatt.. 
'A verf ferious"bLfind*5 caJJs on hiin. 
"" at prerogative and rite of love, 

isy()urdue,iitncdaims;hedoesxckaowledge; . 
it off by-acompell'd Kftraiiit: ' 
i^ant and whole dej^y, is ftrewM with fwe«S 
h&ydiftilnoi^ in the curbed time. 
To make the coming hour o'erflow with joy, 
* And pleafure drown the brim. 
Hel. Whafihis,«iU«lfe? 
Par. That you.,will takeyour inQa«t ieave o*th* 
King. - ^ . . 

^<A^dSTi^ ihjs'h^tfte uyowowngoodiproce^ing -, 

Strengthen'd wkh. irhat' apology^ ^wi&illk, 
-;JVfoH:9i«Jt?..it probaW6,;nfcd. ■-:-■:.■ "" 

Hel. What more'commandslie? .\ . ■ 
Par. That havii^{hfSQbt9iiv'd, yi^ipnriently 
Attend his further pleafure. ) . 

•--ilW- *p <*'«V'^"B->i'«»'t*¥<W'h» will. 
. .^ar- -i ftalJrJfcpftT* it fo,, [£»« Parol^i. 

X ri^4jl-iKay.-)WH4T^eoB(e, Sonji. [ToCkma. 

i&ma. 

* ' ' 6^'Aiii fha/uri Jrhva' Ht hrim.\ HfKatJipr calcco from >a o*et- 
' Ihmring'cup. It is anro^inc boBcAioif nflbfell exprcffiooi inidi 
-^ Siahftr^.- • ■ :r< . . ,■-.. :, . 

\b'> avi.1 ■ ■- ', :;.-.:.■ ' .'-(■ '• - ' - ., \i 

:^ s c e! N'E 



J^4 ^U^ ^ht ISmds v)eB» ^i 

• S C E N E X. 

£tttir Lafeu and Bertram. 

Laf. Bat, I hopc^ your Lordlhip thinks not birtt 
a foldier. 

£er. Yes^ ft] y Lord, and of very valiant approof* 

Z^/. You have h from his own deliverance^ 

Bcr. And by other warranted tcftimbny. 

La/. Then my, dial goes not trucj I took thU lark 
for a bunting, ' 

B^r. I do aflure you, rhy Lord, he is very great 
in knowledge, and accordingly valiant. 

Z^f. ' I ha?«^e thciy finned a^ainff his cjiperiehcc, and 
tranlgrefs'd againft his valour j arid my nate that way 
isdangerou^i^QB I cannot yet find m my heart to 
repent : her^Jjejcomes 5 I prav you, otake us friendS| 

will purloc^tnc amity. 

^ Eftfer Parolk$, » 

Par. Thcfe things (hall be done* Sin 

Z^. f pMfiyKMl,'^ir/ who's bis tlsylorf 

-Par. Sir? 

Z^OiiPkmi^ him welh K Sir, he, Slr^% t 
good workrnaR> ia very good taylor. 

'£gr. h Qxi gone to the King? [^4r to ParoUcs, 

Par. She is. 

3er. WjlFllie^kway to iiightf 

Pan As you^U have her ; ; 

Mir. I hsLvh writ mf iitttrn^ casketed my treafure, 

j^tven Older. for our horfes; and to aight, when I 

^fteuld cake pdSttRon €^ thcfaidc" ' ■ ■ and ere I 

'*Sir1^in 



f. A good travi^ller is ibmething at the latter end 

jSf f(;^^i^^\liutt>ne. (hat lye& three thurdB> and ufea 

a known truth to pafs a thouifand nothings widi, ft^ld 

be once heard, and thrice beaten — — God fave you» 

-.captain.. 

-. i '• *' . . E 2 S€r^ 



51 AlVs n»etty that iindi^elts 

Btr. Is there anyunkindneis between. my Lord and 
you, Mojifieur? 

Par. I knovr not, howl iiavedefcnred to run into 
ipy Lord's difpleafiire. ... 

Laf. 7 You have made fliift to run into't, boot* 
and ipqrs and all, like him that leapt; into the cuffard \ 
and out of it you'll run again, rather tbaa fufier 
queftion for your refidence. . 

Ber. It may be, you have miftaken faim» mf Lord* 

Laf. And (hall do fo ever, tho* I cook him at^s 
prayers. Fare you well, my. Lord, and believe this 
of me, there can be no kernel in thU light niit : th^ 
foul of this man is his cloches. Truft him not in 
jpsxttv of hteivy confequence; I have kept of them 
t^nie, and know their natures. Farewel, Monfieur^ 
1 have fpoken better of you» than you have or will 
(leferve at my hand, but vre muft do good ^inft 
evil. \jExif^ 

Par. An idle loitl, I fwcar. — • 

Ber. I thiiik io. 

Par. Why^ do you not know,kin[i? 

Ber. Yes, I know him well, and^ofimon ipttdi 
him a worthy pais. Here OMnes my <\f^^ 

• -':' •; •. S C B:-N E-^ XL -.' 

Enter Helena. 

Hel I have, Sir, as I was commanded from JWh 
^Ice witlr die-King, «iid have promr*d faislewt 
For -prefent parting v only, he defipss . - 
Some paflv at e fp eech with youw 
' Ber. I (hall obey his will. - - : , 

l^ou muft obrmarvei» Helen^ at my iCQucie^ 
Vfihich holds not colour with, the time \ nor dcfes , 

^' ' ^ ftuih^'vi tnaiefiifi to rim it^\ boots 0Htd (pun olid M,-^ 
kim fJbMksLftdiue ihe -csftard.] It was a ibokry piafiiftM atct^tj 
entertaiDinentt, whilft tke Jtfitr or Zany was in vogue, for him tq 
ioo^ into a large deep cuftard : fet for the purpoTe. Mr. TbiobM. 

•- The 



Ms no^ tkat Bids naeU. ^3 

The mioiftiatioD and required office . 

On tny particular. Prepared I was not 

For iuch a bufincis ; therefore am I found * 

So much unfoded : this drives ise to intreat you. 

That p^efently you take your way forborne. 

And rather oiufe, than ask, why I intreat you i 

For my refpedb are better than they feem. 

And my appointments have in them a mxd 

Greater than ihews itlelf at the firfl: view. 

To you that know them not. This to my mother. 

[Giving a letter^ 
7will be two days ere I fliall fee you, fo 
I leave ydo tO'^our wifdom* 

Hel Sir, I ciAti nolbiDg fty^ 
9Bt that I aitr ydur moft obedient fervant. 

Ber^ Come, comci no^ mc^ of that. 
' Hd. Andei^r^l^ 
With true oblervance feek to eke out That, 
Whcmn tow'rd me my honsicly flars have failVi* 
To equal my great fortune. 

Ber. Let That go: 
My hafte Mi^t^^ gptat. Farewel \ hie home. 

Hd. Pra^, SSfs your pardon. - *. 

Ber. Well^ what wduld you fay ? 

HeL I aminot wc^hy of the weakh I owe ^ 
Nor dare I fay, 'tis mine, and yet it is; 
But, like a tim'rous thief, moft fain would fteal 
What law does vouch mine own. 

Ber. What woukl you have ? 

Hel. Something, and icaree fa mttd i- ■ nothitig, 
indeed— [ycsi-*- 

I would not tell you what I woidd, my Loid -— 'faifhi 
Strangq's and foes do funder^ and not ki& 

Ber. i prav you, ftay not : hut in Itifte to horft, 
' Uri. I fliatl not break your bkldiMp^ gbod my 
Lord. {Exii Helena. 

* Ar. Where are my otfiermen>Monlieur? — fardwel. 

E 3 * Go 



• • ■ ■^ 

Go ihou tbw'rd hbnic/ where I wiH hci^t come, 
Whilft I can (hake ttty 'fword, or hear flie drum : ' '' 
Away, and for our flight. I • "" 

Ptf/^. Bravely, Cduragio! ' '" ^Exeunt. 



^Kfcu^il— w— <fc*».J^*^M»w>i— i*^* il rtiti 



A C T UI. S C E N E I. 

7*^? Duke's Court m Flo re m c e» 



« ■ 



Bourijb, Enter the Duke of Florence, ttvo French 

Lords^ iffilb Sokfierf, ^ 

SO that. From point to point, now hfv6 yo\i heard 
if'he fundartiental feafons of thfe'w^, ' 
Whofe great decifioa hath much blodd let forth. 
And more thirfts after. v' . 

iZjord. Holy feems the quarrel " ./ 
Upon your Graceii part; but black fiHd Tearful 
On the oppofer. ' ;\ - . ;; ' \' ' 

Jpuke. Therefore weitiarvel much, bur c(^(\n France 
Would, in fo juft a bufmefs, fliut his bbfom 
- Againft pur. borrowing prayers. 

z tprdi Good rrty Lord, 
The realbns of our ftate I cannot yield, 
Buc like ^a common and ' an outward man, 
Tbkt the great figure of a council frames 
* By felf-unable ncttfon; therefore dare not 
, $ay. what I think of it, fince I have found 
Myfelf in my incertain grounds to fait 
As often as I gueft. » 
Duie. Be it bi^ pleinlitre, 

I r?-7*«* 0ytw^dman,i i. ir. one not bi die.&cretx)f aftin* 
; P py/^MnaBif uoT^fit} Wie fiwoUidMfiioTiov. ' 






V •*- 



id//*/ nueUy that Bndsnfi^. ^^ 

2 ImtJ. Bu^I mi AitT^ thf yowger of pMr,.i;i9^iQ9)i 

That fuFfeit pn their cafe, will i^y •^y ^J I f> ' ' ' 

Come here fi>r phyfick. . w ^ .,-. •» 

' Duh; Welcome (hall they bpr 

And all the bonoors^ that can dy from us, 

When better fall, for yoar avails they fell } 
To-morrov. M tM fi(^ C^^(«»f' 

& G E N E II 

dam&i to Rouiiilon, in France. ,. 

Enter Countefs and Clown. 

C^att. T T hath happee'dr a}l as I would haire had k i 
X fave,, that he comes not along 5f^ith heu .. 

Clo. By my .tcprfir I take my .yOung Lord to (pe a 
iirery mektoch^y ipaa^ , ^,.xr * 

Count. BTy What obfervance, I pray you ?^ ; , , 

C/9. Why, he wi]l look ijpon his boot, and Img ; 
mend his .ni0*^ and fing; ask qiieftions^ and 44{|f» 
pick his teeth,' and Hng. I knew a man that hacf Ct>it 
trjck of melgiQ^hply, fold a gQodly manor for iiongL 

Count, l^ me iee what, he .writes, and wheQyjtie 
means to come. [Reads the iel^fn. 

C3o. I have no mind to I^^el^^ fince I was ar c6urt. 
Our old ling, and our /j^^j o^th* country , are nothing 
like yourdd ling, and your /j*(f/jpnh\ courts Ijbc 
brain of my Cu^^s knocked put j and I ybegini, .to 
love, as an old man loves mony. with no (tomActi^ 

Count. What have we her??: , . r , . ,,^ 

Clo. E'en That you hayeth?r^.* 1 /. luiC^f**'- 

Countefi «<i<if <i.fc//<r/ ., .'^JJ/ ' 

• 

jT bmf^fM you a ^Mghier-in-Jaw : Jhe bath teeth 
verod tiii^l^f ^nd undone nfe^ I kdve w^ei her^ 

E 4 not 



^ M\* "vi^ ^ I^ "o^tt^ 

joallbedr^ J sm run awayh kn9W i$^ h4<^4 the rep^rf 
€om\ If ibere be hrudib eiMUgb in $bt watU^ I tmU 
bold a lon^ difi^nce. . i4y iM^J Uyo^*^* 

Tour uiifminiate Sen^ 

w 

t 

Bertram. 






^Jl» i&oot well, ra(h and unbridled fao]r» 
To fly tlie favours of fo good a King, 
To pluck hi$ wdignatioa en thy head \ 
By the mifprizing of a maid, too virtuous 
For the contempt of empiie* 

Re-enter Clown. 

• C/ii.O Madam, yonder is heavy news within be- 
<Kp6M two (bldkrs. and ray young lady. 

Cm^. What is fhc matter ? 

(SZft. Nay, there 13 ibme Comfort in the new$, fbme 
eomfdrt -, your fon will not be kiird Co foon as I 
thought he would. 

Count. Why ftouM he be kilM? , 

Ch. So (ay I, Madam, if he run away, as I bear 
lie does ; the danger is in landing to^t ; that's the 
lUft of men, though it be the getting of children. 
Mere they come, will tell you more. For my part, 
f only hear, your ion was run away. 

SCENE DL 

SnHf" Hcksa, df^ two GeniUmen. 

I <Sf/rf; Save you, good Madam. 

/fe/. Madam, my Lord is gone, for ever gone. — 

t Gent. Do not fay fo. 

Count. Think upon patience : 'pray you, gentlemen^ 
l*ve fdt {6 many quirks of joy and grJef, 
That the firft face of neither, on (he dart. 
Can woman me unto*t. Where is my fok ? 

2 Gfttt^ 



AM'^'nMy • fidf^ ^ids natfk ^ ^ 

We met km tkichitrmrd, for tKtoOP 1M '* 

And) lifter ibme dtf^tch ia hand trt coor^;' * '^ "^'^^ 
Thither wc- bend again. 

HsL, Look on this letter. Madam; henTs my pafi- 
port. 
< ^F^Zm tbm^cs$fign tie rmg^ upon niy finger^ ivbicb 
never Jball ccme $ff\ dnSfoe^v me a ebiU higMen 
rf tby body that I amfahof to^ then eaUnit hf^ 
band: bfU infneh a Then / ton// Ncrer. 
This is a dreadful lentcnce. ' : ^ 

Count. Brought you this leder, gentlennen ? 

1 Geni. Ay, Madam, and^ for the oontcnctV fake» 
are forry for* our pains. ^ 

CmM. I pr*ythec, lady, have a better cheer. , -^ 
If diou engroflCbft ail the griefs as diine. 
Thou robb*il me of a moiety :, be was my ioQ,. ^ .* 
Bat I do vaflrbis^^nameoQt of my blood, ^ . . . 
And thou art all mv child. Towards Florence is be ? 
a Gent. Ay, Madam. . > 

Count. And to be a foldier ? ' .{, ^ 

2 Gent Such is bis noble purpofe i and, bel i e rrfty j 
The Duke will lay upon him all the h<HX>ur 

That good tonvenience claims. ... \ 

Count. Return you thither ? 

I Gent. Ay, Madam, with the fwifteft wingof fpeed. 

HeL ^THl I have no mfe^ I have nothing in France. 
Tis bitter. "{Reoi&ng. 

Count. Find you that there ? -, ^ 

HeL Yes, Madam. . , > 

3 m£n thou eanftgtfihe riwgr, 9p» m^fiiger,'] t. §. When {hoa 
caoft gee the riag^ which is on my finger, into ihy poAeffibn. Tl^ 
Oxford Editor, who took it the o^r wa>>, to fignify^ whch thoo 
canJl get it on apon my finger, v«ry fagfiooufly utttfs k to, WM 
thorn eanjlgit the ting from mjptfor. 

I Gent. 



j^8 ^S*i naetti ft^f E^ 'fif'ff^ ^ 

': 1 Gent. 'Ti$ but die bokfnefi of his haAd, htpp*If; 
which his heart was notconfenring to. - - 

Cotmi. Nothing in France^ until he* bsave^ oo wife f 
There's nothiDg here, chat is too goodfw hiai» 
But only ihe ^ and (he dcferves a lord, 
TJsat twemy fticb f ude boys might tend upon. 
And call her hourly mi(lreis« Who was with him f 

I Genf. A fervant only, and a goMiemn 
Which i have (bme time known. 

CouMir PdroUeSt was*c not? 

I Cfe§L Ay» tny good lady, he. v 

Count. A very uinted fellow, and full of wickedfiefs': 
My fon corrupts a welUderived natur:^>. 
With his inducements 

I Gent. Indeed, good lady, the feUioMf has > a deal 
of that too much, which holds him mwh to have. ' 

Count. Y*are welcome, gentlemen (' I .will imreat 
you, wh^n you (ee my fon, to tell hitm that^his fword 
can never win the honour that he loieatinore FU in* 
freAt you written to bear along. 

I Gent. We ferve you, Madam, 'm that and all 
your worth left affairs. 

Qmnt. Mot fi), but as we change osr coiireefies: 
Will you draw oev? lExeumCaiM^y and Gent. 

S C E N E I\r. 

Hel* ^Till I have mwife^ I have mtbini in Fnuice. 
Nothings in France^ until he has no wife! 

4 a dial tf tlmt tio mmcb^ which holds him muth U !»#.] That 
]s« his vices Hand him iii ftead. Helen had befoit deliverM thi( 
Chought'in all the beauty of expreffion. 
■ / ino*Uf him a miorious fydr i 
ThiJth him a great way/iol, filefy a coward} 
,Tjft the/efixi enfiltfiifify in him, 
7%at thty tah place, wbiU nnrtue'sjteily ionee 
Look hleak in the cold nuind 
Bttt the Oxford Editor reads, f§''hich 'hoves him not much to hanie. 

Thou 



■t • * 



^. A 



ThOQ (half hftve flone, RoufiUm^ n6ne in Fr^Hrri 

Then haft thou4siIl again. Poor lord! is't I 

Tbflt cfaaft tbte from thy country, and ^xpofe ^ 

Thofc tender *lmb$ of thine t6 the event ^ 

Of the none-fptirtAg war? and is it I 

That dHte theis from the fpc^jve (court, triiem chdul 

Waft ihor at with fair eyes; to be the mark 

Of fnooaky muikets ? O you leaden meif^gers. 

That ride upon the vblent fpced of fire, 

Fly with falie aim ; ' pierce the ftill-mo^ing kir, 

That fings with piercing, do not touch my lord : 

Wiioever Ihbots^ at him; I ftt him there. 

Whoever charges, on his forward breaft, 

I am the caitiff, that do hold him to k ; 

And rim* Iktit him not, I am the caufe 

His death wis fo elFeftcd: Better 'twere, 

I met the rw'ning lion whert he roar'd 

With Aarp eonftrainc 6f J^unger ; better *cweit. 

That all the miftries, which nature owes, 

Were mine at once. No, come thou home^ RouJUbm ; 

Whence honour but 6f danger wins a fear ; 

As oft it lofes all. I will be gone: ' * 

My bsteg iilM it Is, that holds thee hence. " ' 

Shall I ftay hm to do't? no, no, although ' 

The air of paradife did fan the houfe. 

And angels offic'd all; I willbe gone; 

That pitiful rumour may report my flight. 

To cortfotate thine ear. Come, night \ end, day ! 

For with die dark^ poor thief. Til fteal away. [Exit. 

5 ■ " ' " ■ ilMiVe tf/ ftiD-picrcing «r,. 
TbMtfingi with piirdng^ — ] The words are bene odly Oxofflcd 
into noafenfe. We mould read, , 

— pierce the ftill moving air, 
Thai fings nfiitb piirchgt ■ 

j. f . pierce ^the^air, which h in perpetual motioSy ud fufen no 
H9^ b/ piercfng. 

SCENE 



So AWs Witt, that Ehds noflt/ 



K » 



SCENE V. 
Cbangei ta the Duh^i Court in Florence. 

fkmnp. Jfa<dr<iv23i^<^FloreQ€e» Bertram, I}nyi9 
: and TrumpatSt SoUiers^ Paroll^< 

JD«ib.np H £ Qeneral of our Horfe thou art^ ^nd we^ 
X Great in our hope^ lay our beft love and 
credence 
Upon thy promifipg fortuoe. 

£er. Sir, k i« . 

A charge too heavy for my ftrength \ but vet 
Wc*ll ftrive to bear it for your worthy fafcc,. 
To th' extream, edg^ of hawd. 

Date. Then go forth. 
And fpctiuie piay upon thy proljp'roua hdiOg 
As thy aulpiciQus miftrefs I : . t 

fier. This very day> . . 
Great Mars^ 1 put myic^ into, thy Bit ; 
Make me but like my thoi^ts, and I &a)l prove 
A fever of thy drum; hater of Ipve^ .. iSxitM, 

S C E- N E VI. 
, . CBanges to Roufflkm ifi Frincc. 

Count. A Las? andiwouldyouuketbelftterof her? 
jr\ Might you not know, flie would do» as ih« 
has done. 
By fending me a letter ? Read it agaifu. . 



LETTER. 



M*s imBf tJmi Ends naell. 6x 

LETTER. 

I am $K}^fl^^ pilgrim^ tlnibergonei 

Ambiiious lave biubfo w me efindedj 
Thai bare-foct plod I tbe cold ground upoHj 

fFith fainted vow my f auks to have amended. 
WrUe^ write^ that from tbe iloody conrfe of war 

My deareft mafier^ your dearfon^ may hie ; 
Blefs bifk at borne in peace ^ wbilft I from far 

His name with zeahus fervour fanSHfie. 
His taken labours bid bim me forgive ; 

/, Us defpitefttl JufX>, fenf bim forth 
From courtly friends J with camping foes to live ; 

mere death and danger dig tbe heels of worth. 
He is too good and fair for death and me^ 
mom I myfelf embrace^ to fet Um free. 

Aby vrhat iharp fting$ arc in her mildeft wordi^ 
Rjnaldo^ you did never lack advice fo mxKh^ 
As iettiog her p$fs to ; had I fpoke with hor, 
I could have .well diverted her intents, 
Which thus ihe hath prevented; 

Stew. Plardon, Madam, 
If I had given you this at over-night 
$he Alight have been o'er-u*en % and ye; Hxe writei^ 
Purfuit would be but vain. 

Onent. yfhai ai^el fhall , 
Blefi this unworthy husband ? he cannot thrive, 
Unlefi her pnQTQ^ whom heaven deligbu to hear. 
And loves to grant, reprieve him from the wrath 
Of greatHl juftice. Write, write, Bynaldo^^ 
To this unworthy husband of his wife ; 
Let every word weigh heavy of her worth. 
Tint be does weigh too light : aiy greacdl griof, 
Tho* little be do feel ir, let down iharply. 
Difpatch the moft convenient meflenger j ; 

- - " ' When 



K .A. 



6a AU'S nbelh iikf Enit «^ 

Wheni haply, he (hall hear (harihe is gone. 
He will f eturn, and hope I may, that file. 
Hearing fo much, will Tpeed her fo6t 'again, 
Led hither by pure to^e. Which of th«mt bc^b 
Is deareft to me, Pve no skill in fcnfe - ^ • 
To tHikediftinaioni provide thrs ni^fl^iYgdri 
My bean is heavy, and mine age is %eak $ ' 
Grief woald have te^s, and forrow bids mefpeftki ? 

SCENE Vll 

rf ■ 

.Changes tn a piftli^A, Place /ff JTlOTqnqflu 
. . yl Tucket i^ar off^, y 

Enter an old fFidow, of Florence, Diana, Violentay 

' and Mzvtznz^ witb other Citiiiens. 

*^ M ^^» ^^^^^' ^^ ^^ they do- ajipfoatfh • thie 
. i/N city, we fhaSlJofe all the fightT 

7Xd. They fay, xhQ JFrench Count i)^$ done moft 
honourable fcrvicc. ^ \ • . 

ff^. It is reported,' that he has tSL^tti- theit< greateft 
commander j ^ and that with his own haftd he flew the 
Duk^*s brpther. We have loft ourlabdur, cbeyare 
gone a contrary way: hark, you may kn6w by-chetr 
crumpets. •.. .. ;i. / . - 

Mar. Come, let^s retui:n again, andftiffice outfelves 
with the report of it. Well, Diana^ take heed pf 
this^ French Earl \ the honour of a maid is her name^ 
and no legacy is fo rich as honefty. ' 

ff^id. I have told my neighbour, how you have b<beh 
follicited by a gentleman his companion* 

Afar., t know that knave, (hang him'^ "oM Pah^'- 
les \ a filthy officer he is in thofe fuggeflfietos fbf tht 
young Earl ; ixware oT themi, Diana ; il^ prdrfi^^ 
enticemen^t oaths, tokens, and all x^k engine^ >^ 

luft. 



M's vuiH^ tb0t Ends noell. 6 j 

luft, * are ^^ rlbi^KA^ they go wder ; maoy a maid 
bath been fcduced ^y them > and che mifery is* ex-« 
ample, tfaat.lbr terrible Ihews in tbe wreck of maiden* 
hood) canooc for all that diiTuade fucceffion, but that 
they are lioied ytkh the twigs that threaten cfaem. I 
hope, I need:nottoadvife you further; but, I hope, 
yoor own gwze will keep you where you arc» dio* 
there were ' no further danger! found, but the modefty 
wluchwis fo loft. 
Dia. Yoi| ihall not need to fear me. 

£;i/^ Helena, Jijguis^d like a Pifgrim. 

Wid. I hope fo «^--^ Look, here domes a pilgrioi ; 
I know, flie will lye at my houfe ; thither they fend 
ooe another; TU queftbn her: God fave you, pil* 
grim ! whither are you bound ? 

6 mn not ibt things thtygo undiri\ Mr.Ti^^o^^ /^ttcplains thefe words 
by, Tbp ari not realfyjntrui anifn<e not in appearance theyfiem 
Mk* Uef0p«i'fi^ethifiglike<hi|ienfe>v^lM 
lAether thewor^iwoold fit che fenfe he feems not to five confi* 
dered. The truth is, the negative particle ihould be Unick oat. 
Ml ^kewiidtttai tfaM^ are the things tbsy p under \ i. r. thiy 
flake life of oaths, promifes, i^c. to facillttie their >deflpi npoft 
m. The allofion is to the military uie of covei^'d-irays, xiOr iftdli- 
.tate 90 ^ppro^Ji 9r atuckt and the Scene, which is a befieged 
city; and the pe/fohs fpoken of who are fbldiers, make the phrafe 
•my pt>pef -and- narcural. The Oxfiri EcKeor has adopted tms 
'.fbrTr&w, ibo*:ti».hif iifiudWay, VMtha^) mdtvttds, urehi 
tbe tbiags tbey ge wader, 

7 noyWr/i&fr K|ipwK, but tbe modefij wbjcb is fi^lo^.] Mariana 

'mferJ9iiljiirktot to1)e!iet^e young loldiera* oathi and promlfe^; 

•i)ewi her the mtfi^hiefi mttendiinc on the tofs of Honour ; and cdn* 

findes. tbst flie oosbt to be carefid to prefenre ibat, tho^.fhe were 

(fut (he flioold feel no other ill conie^ne^oe th4i» ohhr ^ lofs of 

her modefty. From hence it appears we ihould read, nefnrtUer 

'inngir Tovni^ bat tbe Medefiy *wbicb is fo loft. Not only on ac- 

ooont of the antMiitffis reftored by the word /e»»in/, which refers to 

1^^ 4 ^m^ wbmkin.SkfiU/p€etr*$ wfi^ is not 01 be oveilookcd, 

«hot priocipaily becaoie che ^cilton here it not concerning the bare 

.itiowledge of /he confeqiienccs ofz woman*s lofing h^r honour, 

'M' concerning' jD/ai«4*s experience oif^ thif matter in net own Ca6 ; 

^^ith which th«#eadtiig hero piopofbd can only agfvt. 

:.. " Hel. 



Hd. Tf> St, Ja^uis li Gnmd. yiiat4o Atfd^: 
lacrs lo^^ 1 do beifeqpb yott? ? « . ;« 

^iJ. Ac the Sc. Francis^ JxGdktho.pon. 
HeL Is this cbe way i [Atuttd^afar ^f^ 

' fTtd. Ay^onrry,. isTt* /brk you» choir- come this 

If.jmi vi|l tarry » holy pi)gii«v,b|2t *cttt cN trobpt 

I willconciuft you whert you. (hall be lodged ft i* s- 
The rather, for, I think, I know jomJ^fitkA v • v 
As ample as . n:^iel£ .,;..- 

HeL Is it youffcif ? ^ ,i ^ 

; Wid. If you fliall pleaie ib, pilgfiQiKr' \ 

: HeL I thank yQu> and will ftay ypM yoirjnlcut. ' 

^^. You canK^ I thinks frooi fmkce. * 

HeL}Jdid ib. k-, . . -^ 

^k/r Here you £ali (ce a countijBomLQf yours. 
That has done worthy fervice, 

Hel. Hii nanie# I pray you? * -- 

£>ia. The Count Roujilhn: know vou fuch a one? 

Hd. Bqc by cbe e^^ tbac^ hea£S..xnoK nobly of him i ^ 
His fade I know nc^ * , . ^ 

2)w. Whatfi)c*cr he is, 
He*s bravely taken here. ^ He ftble from France^ ; 
As 'tis reported ; for the King had married hin ^ 
Againft his* liking. Think ytou^ k- is* <b Y '^ 

/f^/. Ay, furely, ' meerlye truth ; I know his lady .^^ 

Dia. There is a gA)clefYian that fcrvfes ^e Counti . 
Reports but courlely of her. . 

^.^Wbti^ U^ncmie? ^ • 

Disr Maaieuf Pmftbs. '^ 

-JW: jOh^ HseUeM 4^h Jiim, 
.tn argument of praiie, or to th«^wop|fa- 
Q£ Atfigmi CDunJitianfel^ flic*4g iM wean 




To kave her name repeated ; all her dei^rvitig; * -^ 
Ii a iderved hooefty, and That 
I have DOC heard examinM. 

Hia. Alas, |)Oor lady \ 
Tis a hard bmdag^^ Co bocome the wife 
Of a deceftiog lord, 

^Wid. Ah! right; good Oftatiire! wherefoe'er ihe ia 
Her hean weighs ladly \ this young maid might d9 her 
A flirewd com, if flic pleased. 

Hd. How do you mean P 
May be,^ die am'rous Count ibUicics her 
In the unhwful purpofe. 
Wii. He doit, indeed s 
And farakea widi^l, that can in fuch a iuit 
Corrupt the tender honour of a ouid : 
But flieiis arm'd for hioa, and keeps her guard 
In faonefteft diteSk 

SCENE VIII. 

Unm andC^tmrs. Enter Bertram, ParoHea^ Officers 

fmd S^Uiers atteiidb^. 

Mar.JC^ii^s forbid elfe! 

Ifld. So:joui.th$y come: 
That is Ant9m»j the Duke'a eldeft fon ^ 
Tbac« Efc^s. \ - 

lUL Vfi^dihjiitFrencImMf 

Dia. He I 
That with the plume \ *tis a^ moft gallant fidlow i 
I would, he Iov*d his wife ! if he were honefter^ 
He were much goodlier^ I$*t nota handfome gentleman f 
, /fei I like him wdL 

DiA. *X» pity» he k not hweft^ yood's that fiuoe 
knave, 

Thtt'Iuris Mm to ttefe places^ were I his fidy, 
?d poiibn that Vik ra&al. ^I* 

^VoL. HL F Hek 



Sf(i Altt ^/; «latf ^ WF. 

Dia. That jack-an^es wiA fcarfii. Why is M 

mel^Mholyf -:- ^ ^^ :J - ^* ■ 

^rf. Perchance, hc!s hurt i'tV bftttd.. 

PiJA LofcourdfUfiif *cc]k*rr-rt-r.i^ - / ; 

Mar. He's Ihrcwdly vex'd at famcthii^l Lookf 
M? hi9^i^ed us. v. : . . - ? I l^;v 
'^i. Marry, hang you! ^ ^ ^ ^^ 

c. , ( - . L£jtf(f»W Beru^m^ ftr6ncsrj cr^. 
: Mat, Aijd yow: courtefiC) foe a rui^<arfter ! — 

md. The troop is paft : eome, pilgrttti, I wHI 

L. ^< bring yoi!i,\ * .. • i *' 

Where you^ fhall hoft: Of injoynM ^tents 
Tfacre*b *)ur* or fiire, to great St- ^^ijif/aL bouik^ 
Already ac my hou& •/ 

\Msli ikumbly tfakftfe lyotr: • % • 

F]ei&it.tfaifi matron, and this genHe naiA • ^ 

To cat with us to nighty the chaxge and thanking 
Shalt be for. hie:; and:t» requite youfbrthoTi 
Izwiii i)eflDw fomc poecfcpts on this rkffgt 
W0»Ahy the fioce. ^ • 

7:^ Bctb,^ < We*U jcdtouyduf oSst kindly^ . {£rm«^ 



• » • 



. S C E N E IX. 

• ■ » 

^ *" jBii/^ Bertram, V»i /*^ iwo French L^is. 

-x£ori.i Nay,. good my lord, put bimto't: kt 
him have bis way. 

2 Lord. If your lordfl>ip find hiai not a hildiog, 
itdd me no more in jour re&e&« 
* I Lord: On my life, my Wd, a buUMe. - * ^ 
: , JBirv D6;Vou think, I am fp f^r dcjjfcfv^ in hiip f 
o I* Xc.?^\ Believe It, my ,lQrd,:.m minp Qwn dirett 
kuMilcdge;^ without \ any K^ulioe, hut to fpeak of hiip 
as itfy kirifmanr; lie*8 a nicfft^ notable coward^ ^^ 
finite aiidendleis liar, .ai\ hourly prbmife-breaker; tKs 

oi^ner 



Mi ^3 9htt Ends weS. tg 

imatt 6f no one good quality wof th/ yoQr^f£rMlif>'^s 
Mccftatninenc* 

2 Lord. It were fit you knew turn, left^ repofing 
too &- in his Virtue, which h^ hath not, be might 
at fboie great and trufty bHfinefs in a main danger fail 
you. 

Sir. I would, I knew in what particular afiion t» 
try him. 

2 Lord. None better than to let him fetch off his 
drum ; which you hear him fo confidently lindelrtake 
to do. 

t Lord. I, with a troop of Ftorentbus^ will fud- 
denly forprize kitn ^ fuch I will have, wham, i aitf 
fere, he Ktlqws not from the enemy: we will bind 
and hood- wink him (b, that he (hall fuppofend oth^ 
bat that he is carried into the leaguer c^ the adver* 
&ries, whtt we bring bim to our own tents ^ be but 

rr lordihip pudfifnt at his examinadon, if be do ntie 
the promiK* bf his life, and in the higheft com* 
pulfion of baft fear^ :offer to beofy you, and deliver 
all the intelligeiice in his power againft you,, add di§e 
with the divine\foifeit ot his foul upon oath, never 
iruft my judgment in any thing. 
'^ 2 Lord. Oy for the love of laughter^ let him ifetch 
his drum ; he fays, he has a Itratattm fot^t \ when 
your lordihip ^^.the botton^ctf his Tuccfls in*t, and 
to what metal this counterfeit lump of ' Oar will be 
oifclted, if you give him not :' Jiim Drui(f% efttd-tala« 

9 Oar (pelt right hy Mr: Tb^uU: ' 

I John unxm*4 fniertaiMMUMi^^ Btdtf^ftseJ^ in his defcxiptioii jo£ 
htioMd, ipeaking of Patrick '^tarfifiM^ (mayor of thMh in tlie 
liar t^$i,) and q£ iiu ^travagant kckptUtity^ riil^«ifii» that no 
ipail^aii ever a cold or ipr))id4ing look from any part of hi^ fii* 
1^': fo that hitprttr^ •ran^ vtber 'Oficir^ tiwrft noi, fit ^act JUi 
a^iigiw tbiJlMpkft 1»A«, 4bat n/kr1ed U bi$ h^ufi, Tdaa Dhom*« 

^pl0Uinmcrttr.«inb«d a)rtohafe4k'Sap in fay the head, and (hmft 
m oat by ba|,hi>h^ IhaaUan. Mr. JMoUl^, 

t 2 ment. 



^ 



7Q ^ts v^lL th^it Eifds *well. 

ment, your inclining cannot be renioved. Here be 
comes. 

S C E ' N E X; ■ 

Enter P^rolles. 

I Lcrd. O, for the love of laughter, hinder not 
'the hiiniour of his defign/ lee him fetch off his drum 
in any hand. 

£er. How now, Monficur ? this drum fticks forely 
in your difpofition. 

4 Lor(i. . A pox't on*t, let it gp, 'tis but a drum. 

Par. But a drum ! is*t but a drum ? a drum fo loft ! 
there was an excellent command! to charge in with 
our horfe upon our own wings, and to rend our own 
foldicrs. 

z Lord. That was not to be blamed in the command 
,of the fervicei it was a difafter of .war that C^far 
^himfelf could not Have prevented, if be had been tbere 
.to command. 

Ber. Well, we cannot greatly condemn our fuccds: 
fome diflionour we had in the lols of that drum, buc 
it is nbt to be recovered. 
. Par. It might have been recover'd.^ «g|v 

Ber. Ic might, but it is not now, ^ 

Par. It is to be. recovered ; but that the merit of 
fervice is ieldom, attributed to the true and exa£t per- 
Tormer, I would have that drum or another, or bk 
^jacet 

Ber. Why, if you have a ftomach to*t, Monfieur 5 
if you think ypur myllery in ftratagem, can bring 
, this inftrument of honour again into his native quarter* 
' be magnanimous in the enterprize and go on ^ I will 
grace the attempt for a worthy exploit: if you fpeed 
■wcfl \n it, the Duke fhall both fpealc of it, and extend 
laju^u^what furthci: befonKS.bJ^greatnefs, even toibc 
utmbft fyllable of your worthiDe& 

P0r. 



>^ 



-H • 



Alh tveff, that Ends iJoelL 71 

Par/ By the hand of a (bidicr, I will undertalci! it* 

Ber. But you muft not now Dumber in it. 

Par. ril abbut it this evening; and * I will pr^* 
fently pen down my dilemmas, encourage myfelf in 
my certainty, put mvfeif into my mortal prepsuation ^ 
aod^ by midnight, took to hear further from me. 

Ber. May I be bold to acquaint his Grace^ you aie 
gone about it ? 

Par. I know not what th^fuccefs W4II be, my Lord ; 
but the attempt I vow. 

Ber. I know, AW valiant; and to the ' poffibiiity 
of foldierfhip, will fubfcribe for tlice ; faneweL 

Par. I ioye not many words. [JSxit. 

S C E N E XI. 

1 Lard, No more than a fifh loves water.*^— Is not 
this a ftrange fellow, my Lord, . thai fo confidently 
feems lb undertake this bufinefs, which' he knows is not 
to be done ; damns himfelf to do it^ and dares better 
be darnn'dthan to do*f? 

2 L^d. Tou do not know him» my Lord, afi we do; 
certain it is, that he will (leal himfeifinto a man^s fa- 
four^ and for a wedc efcape a great deal of dilcoveries i 
but when you find him out, you have him ever after. 

Ber. Why, dp you think> he will m9ke no deed at 
all of this, diat lo^ferioufly he does addrejfs himfelf 
unto? ' 

2 Li^rd. None in the world, but return wkh an in* 
ventk>n, and clap upon you two or three probable lies^ 
but w< have almoft imbofs*d him, yoa fhall (be his. fall 
to night s for, indeed, he is not for your lordibipl 

2 I wU fre/inffy piM ilovm m; Dilemmas.^ By this WQr4, P^ 
*f§tie9 is made to innnoate that he had feveral ways, all eqaally 
^jBertiis^ of reoovieriiig tbia 9ium. For a Diimmd is' an arpment 

that condades both wavs. 

3 t^ffihiUg of ikf foUiirjap,'] dele tby: the fenfe requires it. 

F^ lUri. 



79 Ms 'M^ thht mdf nvcH, 

I Z4fi^ We'll m^e you ibftie (fK»re^mch'tbe ft)z, 
ere we cafe kini« H^ wsis firft fimak^d by the oH 
]0rd£^| wbMhi9di%QHeiindte]|r1)imd)Ce{ifiie 
what & fprat veu &al1 bri him i «rbidi you fliali fee^ 
Ihui very oif ne. 

z hfrd. I muft go and look niy ttHgi i he ihall bi 
««ght* . 
' Ber. 'toQT brother, he fhail go alon£ with me. 
- % I/f^* Aft plcafe your lorcQiip. I'll leave ydu. 

\ B«t^ Now wUl I lead you to the lMuit» aad (hew you 
The lafi I fpoke of. 

t l/ord: But you fay, lhc*» boneft* 

Ber. That*s all the fault : I fpoke with her but oncoy 
And found her wondrous tdd i but- 1 ftnt to her^ 
Bv this fame coxcomb that we have iW wiad^ 
Tokens and letters, whifch (he did Ht*iend ; 
jknd this h all IVe dodet fhc^ h *fy I- creature^ 
Wil^yca 'go fee her? • , . 

' ti^;;^. 'WithanmjFlieiat, my'lonl. (Z^Hii 

^/. Ti^jQo oufitoubfc me that L»m iwt ihe*^ .T 

* 1 ifrkitow hdt,.ii0#i ^U a/Kire you fuitber^ 

^ But I fliaH !lofeihe?grOBikft I work upon. 

:* md. Tho? m^ tflate be^ftUen, I .wi» well b6i«» 

f«0thiii|r^^^'Md wkirtiiefe bufh^ 

And would not put toy reputatioQ now 

in any ftaifring ■&«. 

fcerfelf to tb^ ^iint. . ^ '* 



r: 



^«I/S& ^ttwfl^ 1^ 7^ 



Firft^ gtre aiexnift, ito Count 4ie is mjp busbandi.; 

b lo, from wor4 to word ^ and tbai yoacaiindt^ , ^. 
By the good aid that I of you ifa^l ootivpn^ . , . 
Err in beftowng itL < . <. ^ . 

i^^. I IhonU believe you, 
iFor you havQ ftsWd me tiiaft which well approrai 
Y'are great te fottune. 

MS. Take this purfe of" gold, 
J\nd let niQ.43U^ your friendly help thus far^- . ^ 
Which I will ovcr-pay , and pay i^a , . . » 
When I have fidfeod iCi -The Count woonjrojp 

4aughi3(r« ,- .,- 

Lays down his wanton fiege before her beauty^t .. . 
Re(blves:« x»rry her v kt hpr.conibt, . . : 
As we'll diredther howf: 'tis bcft to bear it* , . ^ 

Nair bis.i«^poilsii|C bloqA wil| nought fJcay*^, r ^ , ; 
That (hell demand : a ring the Count does wea^ 
That ddwnwird ha(h fuccecded in his boufc ^ 
From ion to ion, fome four or five deicents, ' 
Since thefir^^her wore i(. This Tbg he holdl 
in mod rich' cIiDice i yet In his idle ^rey 
To buy his ^ill^ it would .not (eem too deaf. 
However repented after. 

^ui. Now I ifee the bdrtomoT your porpoft. 

HeL Tou fee It lawful then. It is no more^ 
B^.^lat your dii^hur, em fht Hotak as wHb^ 
Defiret dbtt ring ; j^ppoiaes'him^aQteaanioteri 
In fine* delivers me to fill tbctinac, 
Hcrftlfmoftehaftlyatirent: after riiis, r: 
To marry her, 1% add jAaa xhdufynd aomM 
To what 16 paNft almmly.c?^' v ^ 

fTtd. I have yielded : ' 
Inftrud my daughter how fhe fhall perievere, 
iThst cihi6 and placv/'witb ihia deceit To tik#rfii^ > 
May pffove coberait. £very night iie coi^Mf ' 

F 4 With 






^4 -^^ ^^> ^''*^*^ ^^^ ^^^^ 



To her unwoithin«fSv4r nOthiAg'ftcadt lis 

« A&if <hRPlife 1^ on 't* ' ^-j •» ' ^— ' 

Hel. Why then, to night 
Let us aflay our plot;: Which if k lpeod» 

And lawful meaning in a wicked ad ; 

Where both not fin,- atid yec a ftnfiil faft. 

JBH ktf« sjbout it — T***i - . . .- -: [Exmnf. 



I II III III I I , »i I I ■ 11 I I I J ■■ I I T II I n il II 

JP(tfr^ ^ *itf Fsench Camp m Florence. 



r .J . . .1 



■ . » V 



Enter ^e ^ ffeFitpch Lords, mikjheirjhe SMiers 

* Lord. 

TT E^can cpmc no ptber way but by tbi3 hcdgej- 
JTX corfl^r^;, wljcp you fally qpiin hirp, ftciak whac 
Iterrible. language you will \ thoug{> ypu underftj^od it 
npiyauri^^s^.npjDp^^i for wc ^^lilf^n^w: ^cn t» 



5 Is fwuRe^ meavinj^ in a iahufiJ ietd i * , 
ling r]d4l6 domplMe in all its parts, ' vtt IbouJcf lead the feoaHA li& 

The jfenfe of che \yfo ^nes is this, It is 'a ibicled meaning T)ecau|e 
Aew<Aiia%S liftettf If tOrdkcfr^;*btft^ /ff<E^/ i^/» be^dfr the 
mairexijoys his owifw^^-* Agaiti, k haJBi^ful fMawitig beoiaJ^ 




yctxX iy^iinfdt AoKon both fides jf 

which cmdiifiQa* Mr ibs;; wfuii^nHc. fniWl>finM ^o^wj^^- I 
<:. i ' ' •/ * wnderr 



Ms vi^, ih(t$ 'Esds ^tH y^ 

Lord. Annocacquaintedwithhim? luMMQsheiKiC 
thy ▼oioc? ; . 

Sol. No, SuTy I warrant* you. 

Ln^d^ But wha^ Ji^ficfwooliie haft cboii to ijpcak to 
us agsio? I « ' , • 

ftf/, Ev'n fiicb ju you (peak to me. 

l^fd» :He moft tbiok u$ fome ban4 ^ ftrangeta 
i'th' ad verfiu'ies' entertainment. . No^ be bath a fmacl( 
cf all neighbouring languages, therefore we muft every 
one be a csan of bis own fancy ; not tQ, knpw whac 
we fpeak one to another, fo we ieem to know, h to 
know ftr^ight our purpole ; choiigh's language, gabble 
enou^^^aod. ^oed enough^' . A^^Tor.you, intefpreteri 
yctt muft fixm very politick, (iut couch, hoai here 
he comes,4ab^|iile two hpw^a 19 aJieep,.aod.theo 
to return aod fwear the iie^ he forges. 

Enter Parolles. . ' 

Par. Ten 0' clock ; within tbefe three hours *p9f^ 
fie timtf oiough to go home. " What ftall If^,.! 
{a^e Qohe ? it tbuft be a Very pkufiveinveqtioo that 
Wrfe$ It. '^CHey begin to fmoak me, and difgraces 
bve of latt lih6bk'd too often at my door ; 1 find^ 
my toiigue is too fo^-hardy ; but my heart hath the 
ni «f ijiljin^iwface itandof his cre^jcures, no(ii«ting 
Ae vepQrO:o£aa[>y tongue. 

Lfrd. This is the firft trudx that ^er thine own 
iDQgi|e was guilty of. i4fidi». 

Par. Wh^ft the deiril (hould move me to under* 
t^e the recovery of this drum, being not ignorant of 
(be impoffibility, and knowing I had no fuch yau 
jok ? I mt^ give myfelf fbntie hurts^ and fay, I gpt 
them in exploit ; yet flight ones ikri II not carry it» 
Xkcj will uy^ came, you off with &> little ? and grcac 

onet 



S^ Mf 'tit^ Ifiik Mt 'iM 

ones I 4m ^ |^«^ ti^iiimfofe wtiAtM iJiO'4iillineel 
Ton^ie, I mull-pdf yiMfet<»#lMltter^#6idxlli^«Nnils 
* aitf :taHf ^yftlt andehb »f Bapai/ih taaiKi if yoa 

'-: ZtfH/:? Is it pdffibi^ he ihookl knoiT'^hat he ia^ 
and be ciiiat he isf «^ '- ; ; , j- >, :> \jMtk, 
' Pat» I -WMrid flie cutting <»f ny i^townu 'vAiM 
ierve the turn, or the breaking of mf ^/)dff(;il' Aliii-d. 
Lard. We cannot afford y6tt f^. [^Mdii, 

Par. Or the b^fig«f'rtybean}i^«BMl)t»'tt]^ it 
Hw in Ib4«i^nn. » ; -i .. 

£0Ml. nr#Mkl «M d«: '• C4^A. 

ijorJ. Hardly fcrvc. ' • - '"* i^ ' {^J^m, 
Pat, Though I fwore, I ifttp^ ftAA l^ wiitow 
of the citadel'*^ ; ■ ■ " ' ^:.>-.; v .• . 
ZSrfWJi Hevde«i>> • - ' -: ^^ « - ' {4Mt. 



Par. Thirty fochoni. 



'• ij 



Lord. Three great teChs ^weold ftitfRRniaike th« 
be believed. (,/^de, 

Pt^. I would, I had any drum of the Enemies ; I 
4to^d fwear, I recovd:<%l k. .». ijo.u :. j 
•^ 2)##/ll!^u flial) Jiear one anon. £j^i^# 

* far. Oh! rimlbm, ranfem >^^Hio4)orlkMl^iAiiiMsrQi. 

Inter. Bbikos ihrtmulio mh>5, \; ' ^ *' ^ ^ 
i^or. I know, you are the illWiJUi^rife)iiMil^ >;« 
"And I?(lialMofe rfiyiimt U^ter^f^Hi^ii^^^ V 

Al^cctf^ M9T«» f.». afirris^ note. So in ^ftnur y» • 
j;f/i6«r iwr i&j^^yj&a//t«r/i( full mooth 

*5» IrJ ^ ^ ,* '^ * ' jf 



If there be herie drman^ o^Dane^ Iqw JPut^k^ / . 

SstioM^ Of Fremb^ let iiim fpeak » mtj 

rjl difcover That whidi iMl ^mdp tbe fki^CfUne. 

Inter. Boskos vattvado ; I underftand cbeet and can 
fpeak thy toogjoe } f(^^f6^^i(ik^^rSif^ betake thee to 
thy fakh» for fcventecn poniaids are at (hy ^ioiiK 

i^dr. Qhl \ 

J5tf* Oh, i*ay» pray, pray, 
Jdaucha ravaPKba ^kh. s 

Lord, OfpmnH ^t^cbos voliwr^ > , 

Int. The ^eral ia cootenc to ijpaic thee y€t», 
And, 'hood-winkt as thoo art, will lead thee ^ 

To gaito* froito thee. H^ly t^ou may *ft ipfcKm 

Something to fave thy life. 

Psr. Qhfetmeliyea 
And an the fccrets of our Camp I Ihe v i , . 
Their force, their purpofes : nay» 111 fpeak Th^ 
Which you will wonder at. 

Int, B«t wlc^-thou f«ithfiil|y? 

Par. If I do nets danm ooe. 
. Int. AM'i^linta, .. 

Come on, thou art granted (paop. i&dk 

iJjbcrt alarftm ntpUMi 

Lord. Go, teQ thp Count ^a|^//«8. sukI o^ b^o^ 
WcTve caiM^q Uie wooda)ck9 and wiU kaqp him 

• muffled.,. 

Tin we da hear from then). , 
' SA Captduw 2 will. . ' >. ^ 

. X4f4 Hp.wULbcttRy u»«BpUDOitf 
Inform 'em That 

5^i&>IwiU,8ir. 

Itf 4i .'T^ thn ru Jraqp kiqi^ 4wk imd Udj 
lockt 

1 .> ' .l£imiiti^ 



'. I -« 






iCfBKa 



y9 Mi *weif, ihat Eftis nijl^r 

.\S C £ N Ej II... . i 

• "-(Hianges to the Widvts^s lloufe. 

Enter hertratDj OftdDkni. 

TH EY cold me, that your name was J^QntibelL 
Did. No, my good ^ord, P^iand^ 

Ber. Titled Goddcfs, ' ' 
And worth it with addition! but, fair foul, 
In your fine frame hath Jove no quality? 
If the quick fire of youth light not your mindf 
You are no Maiden^ but a Monument : 
When you are dead, you fliould be fuch a one 
As you are now, for you are cold and ftcrn ^ 
And now you fhoujd be as your Mother was^ 
When your fwcct ftlf was got. 

£Ha. She then was honcu. 

Ser. So (hould you be. 

Dia. No. 
My Mother did but duty ; fuch, my Lord, 
j^s you owe to your Wife, 
• J$er. No mo^€ o* chat f 
I pr*ythee doikft ftrire againd my. vows: .. . 
I was comprfPd to her, but I lotre "thee 
By loV^t^sown fwtet'conftr^nt; ind' will for ever 
Do thee all rights of fcrvicp^ 

Dia. Ay, to you fervc us, 
•Till wc fcryc you: but when you have our rofts. 
You barely leave our* thbrhi i6 prick ouHelves, 
And mock us with our barenefs. — 

fier. How teve I^fwornf, ,/ ""' *' '/ 
*• Dif. *T)snot tfie many oathi^, diatmak^the truths 
^ut the plain £ngle vow, that is vow'd true ; 
^ WliatusBOC holy, thit we fwear. Dot 'bides,' — 

i WhMiuMoi holy, /Woti/ Aw|^rj|flU?>v»i ^e;, jiothio^N 9M>|e 
|lpiil|90i||li|B i^ kind <9r oaths. jSitt l>i4*# » not iicre acctifing 
A *. .- J ii B^riram 



'^s W4 tim ^adi 133^ 79 

Bat lake the High^ft to witnefs : then, praf teH qe* 
If I .ihould fwear by Jove's gi^at Attributes . 
1 lov*d you dearly, would you believe my .oatbst 
When I did love you ill ? this has no holding. 
To fwear by him whom I prot^ £o love. 
That I will work againft him. Tberefioipctyour 

oaths . 
Are words, and poor conditions but unfeaPd ; 
At leaft, in my opinion. 

B^. Change it, change it: 
Be not fo holy-cruel. Love is holy. 
And my integrity ne'er knew the crafts. 
That you do charge men with : ftand no more off'. 
But give thyfcjff unto my ifick defires. 
Which then recover. Say, thou art mine ; and ever 
My lovCy as it begins, (hall fo perfever. 

Dia. I fee, that men make hopes in fuch affairs 
That weMl fbrfake ourfelves. Give me that ring. 

Ber. IMl lend it thee, my Dear, but have no power 
To give it fropi.me. 

Birtram for (weuing by a Being not koly, bot for fwearxag lo Sa 
unholy purpofe; at ts evident from the f receeding lines» 

'7/i tut tbt m^t^ HUbs^ th^t mah tht Trktbi 
Butiht fUinfiwifU*w]^M^ 4kat is .^nnn i true. 

The line in qa^Uon, therefore^ ia evidently corrupt* uid4tKrald'bt 
read tha% 

l^Miuwoi b$if9 tbai mfi fiveart «o/.*BiDBs, 

j. r. If we fwear to an onholy purpofe the oath abides not» bnt is 
diflblved iif the makii^. This b an ahfwer to the purpofe. She 
inbjoiiis the acafon two or Uiree tines afwr,> • 

— tbis has no holding* 

T» /iviar ly himf whom I frtUffijo Uvip ^ . 

Tbai I *//// nvorA afaifijf him. ^ 

f. e. That oath can iiever hold, whoie fubjeft is to offend and dif- 
pletfe that Being, whom» I proiefs, in the aft of fwearing by him* 
to love and reverence.— What may have miiled the tditon J/)to the 
common reading was, perhaps, miftaking BirtrmmU words above. 
By kvis pwmfi»iit €9nfirainit^' to bc an oathi whereas it 
Only £g^ifies« hi/^ mjhrmii ly kn/i. 

Did. 



So AH^i ^iiU^ thtt Endt <aiHL 

< JK#^ Will 76a not, my Lord? 

£er. It is an Honour ^longing to our Hoofed 
Bequeiciicd down from tnony Ancdiors ; 
Which were the grcateft obloquy i'df world 
In me to lofe» 

Dia. Mine Honour*^ fuch a ring > 
My chafticy*s the jewel of oiy Houfe» 
Bequeathed down from many Ancefton } 
Which were the greateft obloquy i'th* world 
In me to lofe. Thus your own proper wifiiom 
Brings in the champion Honour on my part, 
Againfl your vain aflauit. 

Ber, Here^ take my ring. 
My Houfe^ my Honour, yei^ my lif^ be thin«» 
And I'll be bid by thee. 

Dia. When midnight comes knock at.fipy thamber 
windows 
V\l order take» my Mother (hall not h^. 
Now will I charge you in the band of truths 
When you have conquer'd my yet m.aideA*bed» 
Remain there but an hour, nor Ipeak to me : . 
My reafons are moft ftrong, and you fliall knpw chenis 
When back agam this ring (hall be delivcr'd 5 
And on your finger, in, the niglfcit, Til pyt 
Another ring^ that, what in time proceeds, 
lyiay token to the future our paft deeds. ' 
Adidu^ 'till then ; thett, fail hot : you have won 
A wife of me, tho* there my hope be done. 

Ber. A heaven oo^eartb I've won by wooing tbee. 

Dia. For which )iv« long to thank both lieav^i 
and me, 

You. may fo in the end-r^ r* 

My Mother lokl me juft how he would woo, 
Asif ihefat in's hekrtl'flie fays^ airmen 
Have the like oaths : he had fwom to marry mej ' 
When his Wife's dead : therefore 1*11 lye with lunH 

Whco 



J 



J^l t^, thA: 1^4 'f^ $t 

WfacD I im .boned .^Sittct.SrenebmMjatfobni^i 
Marrjr ^em that wtU« I'd liv<o and dkatpsad j^ \v 
Ody» ia this diiguiie^ I chiok'M)Q fin ./ . r 

To cozen hu% ^hat wMkl un^lf. w]o«. l£;ails 

SCENE m, 

CbMges P$ tie Froiich Camfi in Florence^ 

« 

EMkrtUtwo French. Lordsy and twd cr tbra SpUkrsi 

I Lord. \/ U have not given him his Mocfaer'a 
1 letter ? 
2 Lord. I Jiave delivered it an hour fince ; ther^ ia 
ibmcthui^ in% that ftmgs his nature ; for, pii the 
mding it^, he changed almoft into another man. 

1 Lord. He has much worthy blame laid upon hiai 
for IhakinK pflf fo good a wife^ and fo fweet a lady, . 

2 Loro^, BfpQcially, he hath incurred the everlaft* 
ing dilplea%0 of the King^ who had even tunM hit 
bouatf to fingha^pjnels to him. 1 will tell yQu a things 
but you /hall let it dwell darkly with you. 

I Lard. . Wheq you have fpoken i^ *tis dead, and 
I am the gmye ofit. 

a Lmrdn lie hath perverted a young Gentlewornaa 
here in Fkrtncf^ of a moft chafte renown » anci thif 
aig^ \ifi§^ttict h;s will in the fpoilof her honour % he 



Sinci Frehchmen artfi hrmiJ, 



*". 



"Marrjf eitfwH, TU frve and Me m Uaiii\ 
What! becaole Frtn^hmtu wew falfe^ (he, that was aa hattan^ 
mUfliM^Bibodyv Thateatueomiptedi luiwaikoiiUieadp 
> ■ ■ SincifrtnAmakmnfiirmidp 

Mmny Vm thai nnUi^ FU hnaanidu m m^iJ. 
i e, iinoe Frtnchmin ffcfve fo crooked abd perverie ia UtA* niiu 
tttn, Ut whcr mSt warty tbern; I hadxatho: five and die i ftaSd^ 
Aaa vcBatimr qi«pifhm. Th»itebyiwitharicw4D£r4A»». wini 
^9carod j^ food of b^ hosbaad^ mM. went tW fo «any diflici*. 
tjcstaobtaicfhiltif . 

^•^iV hadi 



8 z iUU *weff,^ that Ends ^anflf. 

hrA given her his mpninpcntal riogi %pd thinks hio^ 
k\l made. in. c|ie> utyrbaftc compolitloii. t ' . 

/z Lor^f Now G6d delay our rebellion i. as wq are- 
Qiirierves. what things are we! 

. z jjfra. Meerly our own traitors i and, as in the 
common courfe of all treafons, we ftill lee them reveal 
tbemrelvresg^'till they attaip to their abhorred ends ; fo 
hCf that in this aftion contrives ag^inft his pwn Nobi- 
lity » in his proper dream o'crflows himiclf. 

1 Lfird. U it not meant damnable in us to be the 
trumpeters of our unlawful intents? we (hall not then 
have his company to ni^t ? . 

2 Lord. Not till after midnight ; for he is dieted 
to his hour. 

1 Lord. That approaches apace : I would gladly 
have. him lee his company anatomized, that he mi^c 
take a nieafure of his own Jud^mem^ wherein fo cu^ 
rioufly he had fet thi$.QOunterfeit« 

2 Lord. We will not meddle with him Vill he come i^ 
for hisprefence mu(Ebe the whip of the odber^ . ' 
- I Lord, in the mean time, what bear you of thelc* 
wars?. 

2 Lord, i bear, there is an 6verture of Peace. 

I Lord. Nay, i adto you, a Pease 'condodedi' ' 
.^ Lord. WhatiifilLCounti&»,^&9i^theh? 4iU 
b&trawl-hig^, crrBturD<igainiotoA^Mnr/> < i 

M Xari« I ^touttt-jhf U\m deaundr-yoi aiv aer 
altogether of his Coonal. 

z Lord.. Let k beforbid^ Sir! fo fiieuld I be a great 
deal of bisaft» 

i Lord. Sir, his Wife fome two months finoe fled 
from his Houfe, her^rectnce is a Pilgrimage to St. 
Jaaues le Grand ; which holy Undertaking, with moft 
auitere fanftimony, fliejaoo»mpUih!d -, and there re0d- 
ing,^. -the tcndemdOt of her nature bcane aa a pc^ 
toiler grief i in'Ene, made'^ a groan of her laft Um^ 
and now Ihe lings in heaven. 

2 Lord. 



Mi hveWy that Ends' nveff. Si 



' 2 ^i^j. H&# h this juftificrf ? • ; /^ ? ' \ 

f LptJ. The ftrongcr part ofh by hor pwn^fcttcrrf,'* 
#hich makes her ftory true^ eycn to the poisi of her 
death ; her Death it feff (which could not be her oT^^ 
fioe to fky^ is come) was faithfully confirmM bj die^ 
Reftor of the plafce. . ^. P 

2 Zi^i^. Hath the Count tU this inteingeftce ^^ ^ ^' 
I Lard. Ay| and the panicular cbnfirnfiationsi^' wnk 
from point, to the full arming of the verity. , *' 
' 2 Lcrd. I am heartily forry that he'll be^^dW 

this. .-. ^ *"* ' ■•-'**../'; 

t Lard. How mightily ibmetimes we make lis 
comforts of our loflesT * / ? . ', 

1 Lard. And how mightily fbme, other tinies we^ 
dtown^our gain in tears ! the great dignity, thkt his ^a-^ 
lour hath her^ aoauired for hlnf, fhall at home be'^en-^ 
etabtcr'd with alhameas ample. / " ^ .^ 

I Lord. The wd>of our hfti is of a mingled ararn;" 
gbod and ill toj^ther f our yirtcffs would be j^i^oud^ if 
oorfisiults wh1)>tWm'not} and oor cnmcs woiuid d»^. 
^air, if they were hot cherifli'd by our virtues. 

How jooW ? wfanefs foor Miftap f . . i 

, Sir. He «Knd<DQkemthe)ftMt» Sir, of wImu' 
k hach takcD»i bkamkinrtzhn Lordihspwiilinari 
OpriMgforAwMi TheDvMeilMdiogGfcdhittkt- 
ters of comroeodatioos totbeXiflf;. 
«. a Lard. Tb^ Audi be » JBore^ban ncedfiil thci^ 
if they were nooit than they can commend.., 

- S- C E N E IV. ' 

■ 

•^*r AjjI-.^Tteyxannot bc'tod fweet for the ICing'f 
tiiSS^ f Ifcfc's *his Lordlhip nqw. HoW now/ tnf 
Lord, is't not after midok;hrf 



Ber. I hay? to nighi^ dto^ Wmq^ifAwfts^ « 
mo(«|^'« k;pgt|» a.RM^re, by, ai^, a^bjjl^aa, 0|f fv^f^^ ij I 

h^j; m9*^r,. Im rcp»i»ing i. eateruiw!d,my.c»n«)I,-iu 
and, between tnde main parcels of difp^dH ^^^^q^f^b 

many aice;r, n^& :. thcJaft Wf\f..t^c,gr^JWli 'WtT^iC • 
I Jfl«»'not«nd?d ypt. 

' 2 Lord. Ifj tlvB.l»v^i)efe. l)^.ofi any;<^cu|iy, s(k^ 
tW? iwfniqg,yovr <^<:pai;tuj[e,hff)cc,. it requi|j5n. ha^ 
or your Lordlhip. 

-Bar^ Ijmpap, thj^JbM^^fvs^wcepdjpdi as«?atH»fi^ 
hear of it iiereafter. But (hall weit^yie thi& ji}if^og(|$i lifli; , 
t^H. t}u^ fool and- ^e.foldjfri cfxi^et: *> brtfig, fo^th 
thwjcp^nflofcit Miccjal v lv!af^eqay!d:«ijB, liiu;a,4MPr. 
bjcrinei^oing, propH^l^er. 

a.Zw^: Brihg him.^rrti j;h;^4«S «9t*«5tt?fcfc 
alLjiight. ppQf g*|)ajjt.lqnajfp, -^ 

I -£0ri. I have told y^ur Lor^flkip already i tke 
Stocks carry him. Bat tb an^veP you as ybu wbttld be ' 
nnderftood, he weeps^Hke a wetKhttneh^ibedvfiM'* 
lattlii;. iohftA con£E&'4 htmfctf to Mv^ttiTi whom he 
f9ffeS».ta. be Ji- £ciar, fi«m-tbe tme ^ M» rdtidi»>'^ 
biBMc, . iktiiins. ver|Mi^tamt.di&fterefv'bb^ l<ttitei*d#)<'. 
Stocks 4 and what, chiiik you, hehayfi<pAftftT' • 
.Bnu bloching of -me, has hie ? • 

zLerd. His>«M£»ffioi»^isvtakett^ andtjt>Jliall>t)M«ad* 
to bis face: if your Lordihip be in't, as, 1 bd[ievc9 
you are, you mft hwc ths paiicnccto hfcar it. 



to a flr£,<^/*, ^whiqh prpfejes to bq Uie counterfei^i^£*ii^jtlicr^hin|^ 
Wft^lhouTd read m £ o a t« And this clie dx/ir/ Editdr foUo«a. 



.^&hr 'uitlty ph^ Bids njteUi $3 



' 4 



> "T 



thing of me \ hufli !^ hulW 

Int. He calls for the t9raim<)' what will yoir fiqr 
wwhopt '^7 

Par. I will confefs what I know^ witbQtl^conftraiar| ; 
i(})0rpif«th>ineJikea>pgfty, I«can fayno moie« 

^/. Sosi^ CbiiftMrcio. 

% L^dk &bIibindo cbUt^wurco^ 

iJbi^ YpK^are^a in€iK:ijful Gmmil: Qur Gcndhai^iy^ 
y.ott-aaiCwQr co> wb^c- 1 (hM ask you one of a joottu 

ri^iin AndcruiyK as^I hopeto Hvefc 

tj^ Firdr dw9^fl4<Qf hits, how^iniiny Horfethe^ 
Sake is* ftrong; What fay you-to< th^xi 
tiNf^ FiHGriOv* Ax thw&Ad) but v^yr wcdk audi un« 
ferviceable : t^e tpoc^ are^ill &miF% and the Gomvi 
oMlpdars very poor r<^qts»- upon my^ reputarioix«id6d 
cqmjIm:^ Md^M IJk^-IQ live. 

L$t, SfaaU I iec down your anfwer (b ? 

Piir. Dp) rU cake the Sacrament oa^c^ bl>w aai^ 
wlw:k ' waf y pu will : al ra^ooe* (d me. 

Ber% Whac s^ fi^ft-iaving Dave ts<his ! 

:l Zimiti* IfiV^ dfx^eiv'd^ my Lord^: this i»Mon0«tta 
Ba/r^llHy* (he g^i^ naUicarift, tint wafr hir «#av 
phi;a^,tha(.h^*cho wthole thccHry of war in At,kn» 
of hisr fcacf|« and: tins pradice ici thi^chiipc of im 
dagger. 

^tifiNL I'witt ntver- truft a manajg^n Ibr kac^Ag 
his (word cka&s ^nor believe, he caa have- every thiii^ 
m him, by wearing his apparel neatly^ 

Lu. Well, that's fet down. 

P^p.^JPht'OT fix thoufand horfe I iaid* (!< will fty. 
ime) or thereaboius, fet down, for Pllfpeak tFtftbi 

I Lord, lie's very near the truth in thiav 

G 2 JS(r. 



84^ AJVs nveliy that Ends nveil. 

Bfr. But \ con him no (banks for^Cp in ij^e nature 
he delivers it. * 
Par. Poor rogues, I pray you, fay. 
Int. Well, that's fet do.wn. 
Par. I humbly thank you, Sir : a truth's a truth, 
the rogOes are marvellous poor. 

Int. Demand of him, of what ftrengi^h .they arc t? 
foot. What fay you to that ? 

Par. By my troth, Sir, if I were to five this pre- 
fent hour, I will tell true. Let me fee ; ^ Spurip a hua- 
dred and fifty, Scbafiian ib many, Cf^amhus fo many, 
ynques ib many $ GuUtian^ CofmOj Lodotvick^ and Grar 
tiiy two hundred and fifty each ; mine own company^ 
Cbitofb^r^ Vaumond^ Bentiiy two hundred and fifty 
each : fo that the mufter file, rotten ancf found, upon 
my life, amounts not to fifteen thoufahd Poll \ half 
oK the which dare not fhake the fiiow .fipm off* their 
cafibcks, left they (hake tbenilelves to^pieces. 
^ Ber. What Ih^U be done to him .^. '^ 

t Lord. Nothing, but let him have |iunks. 13e« 
mandof him my conditions, and what credit Ibave 
with thc^^Duke. 

Int. Well, that's fet down. You ihall demao^ 9f 
him, whether ope Captain Dutnain be i*th' cairip% a 
Frenchman : what his reputation is with the Okik^* 
what his valour, honcfty, and expettnefs in war ; or 
whether he thinks, ft were not pofliblc with wdl-weigli- 
ing fums of gold to corrupt him to a revolt. Wnat 
lay you to this ? what do, you know of it ? 
r Par. Ibefeechyou, fet me anfwer to the particular 
^{ the Interrogatories. Demand them fingly. 
Int. Do you know this Captain Dumain f , 
Par. I know him \ he was a botcher's prentice in 
Paris^ from whence he was whipt for getting t|M 
' lheriff*s fool with child j a dumbinn9Cienvthat<:oa!d 
not fay him wtfv. 






Ber. 



^ 



M^s tvelt^ thdt Bnds ^eU. fi 

Bier. Nay, tiy ytoof fea^e, hold your hands i tho* I 
know, his brains are fbrfeic to the next tile that falls. • 

IhL Well, isthisCaptairt inthcDukcofJPifcr^/i^A 
Camp ? 

Ptfr..Upon ifiy knowledge h? isi and lowfic. 

I Lord. Nay, look not fo upon me, we fhall hear 
of yodr Lordfhip anon. 

Int. What is his reputation with the Duke? 
• Pdry The Duke knows him for no other but a poor 
officer of mine ; and writ to me the other day, td 
Htm him oar d*th* band. I think, 1 have his letter in 
Ay pocket. ' " 

IihI Marry/ wieMl fearch. 

Par. In good ladnels, I do not Icnow j either it is 
xhere, or' it h lipon the file with the Duke*s other let* 
tcrs in my terit 
" /«/. 'Heri 'tis, here's a paper, (hall I read it to you ? 

Par. '1 dt^iib^ know, if it be it or no. 

.Ber. Our Interpreter does it well. 
^ ' 1 2if*;^fti;^ellently. 

int. Idl^, the Count* s afooly and full of gold., ^ 

Par. That is not the DuKe*s letter^ Sir ; that is an 
)KfverLiieuitAit'^6 a proper maid in Florence^ one J^ior 
M* tb take heccfof theaUarcment of one Count Rou-- 
fikfty % foo^ idle boy ; but, for all that| very ruc- 
tllL I Wy yotiV Sir, put it up again. 
' Jbst. v(^fi I'fl read 'it firft, by your favour. 
* Par. My'meaning in't, I proteft, was very honeft 
in the behalf of the maid j* for 1 knew the young 
tbcmt to be a dkngerous and lafcivious boy, who is a 
whale td^^tfkj^ and devours up all the fry it finds. 

Ber. Damriable ! both fides rogue, 

-" ^ ' " * ftiterpretef reads the letter. 
]pfe*f htfUd^ari iaih^ bid him drop gold^ and take it^ 
^ ^^^j^er he'jfh^es^ be never pays thefcore : 
Halfwon^ is match well made ; matcb^ and well make it : 

Ht n^er pays after dehts^ take it before. 

G 3 Jittd 






it 



$6 ^V *mS^ ^xet Bub 'iifnL 

MflM firt fif tnell teith, he^s are iiO!t:ifiJ0i . ., "* 
^, 'iiiftnt of ibis, tbeQttnt'sjdfMly jr^««r/<'>.:;^ 
ff^pafs brfortj but not when be dees owe it. - >^ ; 

. iliinc, as he vow'4 to th?e io Ainee*, :| 

^«r. Helhall be w^pt(hr0ughthe^ri»y withilhis 

^hime in his foreheiid. - \ 

{» ILord, This is your^G^otcd frioafl^Sir^ th^ oiani- 
fold linguid, and the arm i- potent {bldien . . 

B^r. I could endure any ichiq^ before tift It 'Ca;^ -and 
NllOir Jh&*9-,a cat to nie. 

ZirA. I peroeiyie, Sir^ Jb^ tb« Cfperaj'? looks* ^e ihftU 
lie fain to bang youw 

Pap^ Mjf life) Sit» 41) Qiny pa^ie i jnot-tb^it J^b^ afraid 
to die) 4>ut that cpy oj^eoce^ beiogoviy^ J ^Quld re- 
pent out the remainder of nature. Jjst ufpiiv^^ Siii^ in 
aDu^on^ i;th' Soocks, any wlxerc;^ Jfol ingy.H^q. 

Ifit. WeUi iec vbat may be dot\e« ib|iMi confefs 
J^^ely ; dicrefore, once more^ to thia Captam Dim^n : 
ydu have anfwei^d to his reputation wid? th&P^ke^iM^d 
CO his> V^kHir. Wbat is his Jiopcfty ? . . . ^ . 

^i^r. He will fteal, Sir^ an egg .oMt?of a dcatbk i 
for ri^s And raviilunehts he paraTtel5:.:A/^i. Hepi0* 
fefie&»<?. keeping of cndie 4 in bi)eiriQBi^.cli«tn he is 
Pxonjger than Hercules. He will lie;^ Sir, wjfth fuch nro* 
jnbAtiyi thar you wcwld think, truth frene a jooh 
(Jr^okennefs is his heU virtue, for he will be fwiqer 
^rutife^ and in his Adsp he dpes Utile hariQ» &w » bi^ 
bed-cloaths about him -, but they know his condkffM|$» 
and lay him in ftraw^ I have but Jitfile ixrore to fay^ 
Sir, of his honefty, be has every thing that an hon^ 
tnan^fhould not liav^isi what an honcft;man ilKiuI<l 
}MrV«y he Jii9 nothing. - . . .. ^ • ,> 

I L^J^ I begift ts kart him &r<lhifti. .j ... • ^ . 

r •- Ber. 



M*<f 'wHi ^aa Bkis me^ % 

Jl». f^'diH(ddcri^ttoh of tUite hatteStf ? ^:^i)p^ , 
m liho for xac^ he is moVe and tfKtfe-acac^ , ■ . 

IM. ^hi^fij y6u » his ^ipeftrtefi in Wati? 
" IPM*. ^id>» Sir, h'as led the dfwh befdrc'tlie £l^ 
l|lft Trt«:i!dians : to bcHe him, { will n6c ; ahd'Wi 
bthh fMditffAJ^ I k:iioVr Mi <'Mcte)pt, in tffttGouri^ry. 
telinAtKlhonodr to ^ the Offldo-'at k j^ebtKbife 
odl'd A£U-ettdy to inftraa for the doabliAg tf files, t 
^ffMld ^o«clte tmti irtiat BMottf I o^.t bdt df thb 1 am 
noc certain. 

-I iElw^/^:MWlMdi!c(tJtJ^i^kk*dytlkny:fefar, rit^tche 
fftHty fedtenw-him^ 

■• Ber. IV;<pikx^ofc'hfato, l)ie'&a^Acfini. 

Lit. HisQualitfes "be^nigat thi9>poorpri(^, f4ieed 
not t«> asbf ytfi^ if 'gc»id wiH c!UT«({>t bfmtoftv6)6 

Par. Sir, for a ^art-kPetu^ hie wil) fell the ftc4fim- 
{rfb of Mi tEHttlkn, the irtheritanoe of it, aAd cm tb'ino 
tail from all Tmnunderi', zadk perpfietua} ftictfmoia f4r 

i^/.- WhiuVhbBrotber, thrbt^ Di^in^JZWnO^f 
a- ZW«?.'Wht doe* hie ask hiih of ine? ' 
JUft WhaiTs he? . — ■ ^ 

^«^-^i%ti'b ciroi#<aHh'-fadik r^ ; HOC iliogibther 
fo great as the fitft in gqodoefi^ -bat greatei'a greac'diU 
. mevH; fft deeeh his ft^ther for a 0>v^rd,-7tt his 
ImHttr k M^tttid one of the beft that is. I n »'||«treat 
fafc^MMIirtliui^ ktquey } marry', incomihgohhfeEha 
• the cttliiitt- ■ 

ft/. ItyoAriift bb&5^4 «riii jrttuandert&ke to Be- 
tray the FbrenHfu f 
' Par. Ayv6ndthtCat>tatni^hiihoile»Co)ioi:J?«s- 

moH. 

m, V\\ #Irilpd ^h the Genbal, and kix>V his 
"j^eaflnt. 

PiW. iMlno«ibi«dniminiDg» itpligtieofaildramsl 
Only to feem to ddetve well, tod to begoilfe the %- 
fiMBUfeh oftbit hildviDiii yetlhg boy tfate eooati fa&ve 

G 4 I rqn 



8^ M*A nMti tUt Bhdsm^U>K 

I run iot0^dQ]geicl jMft 5K^a would )^Kt Si/jftdtut m. 
ambufli whqBtn: 9(^1%^ * w. . ,- j w l^^^dei 

dni^^hmMf^ reqicdf. Sir, Iwt;,^ mvfttke ^^thcr 
C^niea4iAUfAi ^ou^^tHM h«ve.fo cmtBGroufly.difcovtred^ 
the fccTtUk.Qiyqm ^^^Vs^ tnd m^de^iiidi pcftifcroifl^ 
rf^cq[t!| of men very nobly held, can fenre* the world 
for no honed ufe j therefore you muft die. Come» 
headfman, off* with hv hesd. 

Par. O lord, Sir, let me live, or let me fee mf 
deatb.-^ ' . ,. . . . ^ 

InK That fhalt you, and take your leave of all your 
friends. [Utiii»dwg inm. 

So, look about you i know you any h^r;? 

JBir. Good- morrow, noble Captain. ' 

2 Lord* God blefs you^ Cawin ParelUs. - . 
. 1 Lord, God fave yoo, noble Captain. 
-2-Z^ir Captain, what Greeting ^11 you to my 
♦^Lord Zi/2/ifft ^ 1 9itn for' France. 

I Lord. Good Captain, will you give nje a copy <^f 

'^that iame Sonnet you. writ to Diunain behalf of the 

CooiiC Roufilhn ! \f \ were not a very coward, IM 

compel it of yoU ; but hvc you welh [^^nt. 

Int. You are undone. Captain^ atl but your fcarf i 
ibat hai^ knot <xi\ yet. * ^ 

Par. Who cannot be crufli'd witfaaP}ot? 

J luU If you ^ould find out a Country vhere but ^O^ 

men weiethat had receiv'd fo much (hame, yop m^fat 

begin an impudent Nation. Fare you wdl, Sir> I am 

. for France too, we Hull /peak of you there. [Exit. 

S C EN E VI. . ^ 



Par. Yet am I tbtfAkfiiL : if aij heart were great,^ 
*T would burft at thi$^< Captain Pll be- no mc»ie, • 
Bpt i will eat and ^rmk, and flqep as Ib^ ^^ 

As Captain fliall. S imply' the thing I ^m ^^^ 

Shall make me live .-who knows himftlf a braggart. 

Let 



^.i. ; X 



TMutf^ eirerv braggm (haU^i^i^AddmiiMi' '' a% :^^ 
Biift»iWoMiiiMi^:Uii(Kest^«li^' A^«ft/; Ire" 

£& after tfativr. ^ . ' * c: n * fJE^K^, 

SCENE vn. 




5 Vil. '^* 






Changes to the Widow's Houfe^ at Flwenee. * 

JEftf^ Helena, Widow and Diana. -'^n 
i5&/. np HAT yott mgy w^U j^roeiv^ , IJiaiwii^oc 

One of the QfJ^A ^^ ^^c chniliaD world 
$b9dl be ;e^]| SopetyK 'f^c whofc Tkonc. •cik^iarfful, 
Ere I can perieft mine, intents,. KyJbn^L , .1 ^ . 
%vBO^yf^rX ^id^him a defired office . ^ ; 

|>^alu^^4% ^ifc '• whicb,,:gtati(Mdc , . vu ^^ 
af hroqg&J^ty. sr^^i^r's hofopK would peij) i«rd^T( . . 
Aod aniwer thanks. I duly ana^ infprm*d^- ^ !* r^m' : 
liis Gcace is;.9t Marfiilles^ %o which plac^ . Y m\ 
We have convenient Convoy \ you puft kiV)ie^; k s 
I am liq]f)ofe4 4^ > ^he A]raiy braaking» / ^ v V 
My hmbaoa iues hioi home ( where^ heaved aiding^ 
An4 by. the *fave of my good lord the Kisg^^ a ^ 
Wefll be bpfofc our wdcomci^ , 

Wid. G<a)tleJMadara, 
Tou never had a fervant) to whole truft 
Your bufine& was more welcome. 

Hel. Nor you, Miftrefi, 
Ever a fricodr whde thougjics moit truly labow 
To r&ompenfe your k>ve : doubt not, but lusav^n 
Path brou^c 0>e up to be your Daughter*! dowcr^' 
^ it hath fatfd her to be ^ffigrriaotive 

i my modvc] m/i v# for affifiant 

And 



90 J0l>tytj^ HuU ^kib^% 

Aiulhdpetib^htAmd. tfiiit, Otftr«i:i|^rfift^^ 
That can fuOt Avc^tmrfe Mikb (ffwiUc'tMyian^ 
« "Whm FsMGjr, %ruftmg 6f *dle(sbzte^cl thboghi^ 

With wbR It kMfas. fer tixlt ^triiieh 1ft ^Wsqf. 
Bot Mftore of this hereafter. You, DiaMi - 
(Under my poor inftrudions) yet muft fufier 
Somethmg ih My behklf. 

Diaffa. Let death and honefty 
'Go with yoilr4n3i)ofittbnS) i«m)yoiM 
"Upon your will to fuffer. 

; 7 But with the word the time will bring on fumtnet^ 
'^hfeh'tiriireibalVhaVeleai^tt a^'Wclf * fitoras, 
- And be as fweet as iikap: vft '(aim. kw^, 
* OorW^gtm is ptiepard, and tiVWe it^A (Ki 
-^jflhvD^h mtt tfMtismS; ftifl the feme's AfecrtXrti^ 
? W hate'y the courte, die Wad. is lihe t^abWuM^mit, 

•nal adaltery. Bat tmfting ft mifbake canaot mtke'mB^'OQe ^ail^r. 
We flioold ready and poin^ the lines thus, . 

Wbtn iTAN'ct, trufting 9ftU c^^cemi iJlfOUghs, 

BrfHtfAtfied^yiiibf. 
f . «. the^ii^ bi- imtigiASAitilH tlMrit he ky^Htftk hH llllftitft» d*>* 
«t iMiis ifidoed» his Wife^ moMle kirn ncnx «kd tuikdf a4utofy. 
^^r^^/, by the tncieots, was reckoned odious^ meefte* and ao<> 
minabk. Tbe Poel^ aliixliflg to Hits, fays, HiricR great beaoQr, 
/)(^/» ihi fitcby mght, i. #. ifliafets th6 n2ght» iiMre chah cwditiary, 
abominable. 

7 J?«/ with M W5r4 4^iimtimllh^mt/kffimer^1 WM IS^ 
<iv9r^, /. ^. in an inllant of time. 7 he Oxford Editor reads (but 
what he means by it I khow not) Bear <wM tbe <wori. 

8 Our tcaggcn is prepared ^ ii%d tt^n revifiei tu ;] The ^Oiti Ru 
nfhvi^nmM:^^ fa Yk\.\t linCe, that it ibeths ttty liable to fefpicidn. 

■ ' ■' ■■' -' *■ «M//#tai«r6vye« us \ 
f . #. looks Qc in the lace* calli upon us to hailen. 



SCENE 



Mr^Mi 4hat dkU Wi, ^ 



i.^ 'I 



- « 



S C £ iJ 6 ViU. 

• » 

JS^tfcr QvinteiS) JUfbV) .^^a Clown* - 

1jj/1 IiJTO, no, no, your Son was mif-led -with ii 
jLN fnlpt-tafFata fcHow there, "^ wliofc vilfeiri- 
oixs ilifiron would have made a!l xhe tmbak'd ^idow^ 
vouth of a J3ation in his colour* Your daxighter-is^ 
law had been alive ac this hour ^ and yonr ion \xfft at 

9 <ivi6^ ^iiiaintmt fi^ron *wou/iiia*ae mail ntl fJk^mktti'oad 
imufjouib of a nation in his colour ] Parolles is Vtpfdbattd lA 
MnfeiSted IbilowerortJbe faAMon, end'»n'M€o«iBM>Df Ms^kimAer 
to run into all the fblUes of it ; whopie i^ &f % -l^ /r «Mrr >^ 
nous ^r^mo^ ig iho moifU Zor^— they wear thtrnjiku^ in thi cA 
iftiwii-'-'^und M ihe I>€'vit hai the -meafitrt, fuch ttre tc htfU- 
lowid. Here fotnr particularities of ^flnonable drefs arib ridicnMi 
Snffi'ififff/iim wnA% no •eapknatioa ; <bot wUaind^J^Jhon ii more 
oucure. Thif IaIMcs to a pbasttfiic Atbioo, tken much follow^ 
td, wA ya&n% ydkw ^nh for tbcir baiidA and nffiu So FUffb^^ 
m his <i^itfM ^^Ckmndi, 

- ■ ■ Has h* fankilimrip 

DifiikUy$kr jtWow ias^ i §r .JaiJ yount^ntlii . 

Wmj mt ixaafy frtminfii ■ ■■■> 

And Jahnfiift J>iwT%an Afi. 



Cmrmei itmd tkiimtjhfiutefm -art ^uHm M/ jrrfkMr flai<di. 
This was iDtoiled by one 7Krff#r» a *ctr6*W0Duyi« A*«^rt4»,wd s 
«ad, in ittfiefptAi, «flb iniuBviM « ffcihiaar, <luK her iovvmion 
dcfenred the name oi 'oiliai$mts fajfron. This wonaa was, after- 
wards, amoogft the mifcreants conoemed in the murder of Sirf2i» 
iui/ Ovirhtfy, for which ihe was haiigid at ^tt^m, aftd W9tild die 
in zyoUow rnffoi her own invention : whidi mdle |cUow ftareh £> 
odiou9y that it iaunediately went oat of fiUhion. *Tis this, then, to 
which SiNiiiAmr alludes : hiK ufiag ihe word/tfron forjv/^w, a 
new idea prefensed it fel^and lie porijies his thought under a quite 
diferent aUufion > ' ■ ^^/o viuaimtu fi^r^n njMuldbai^i madi 
sli ibgimhaktd m$id M^yuibs ofm nation in bit i^Unr, Li, of hii 
temper and difpofition. Here the general caftom of that time, of 
Golonring pajte with faSron, is ailoded to. So in the Wiati^t Tali t 

1 taufi iavi faffrm to colour tbo njuarden fyes* 

hom^ 



^1 Airs 'well, 'that Ends nvett, 

hofnfcy' * more advantaged bv the Kihg, than by that 
red-tail'd huinb!c-bee 1 fpcaK of. 

Counf. I would, I had not known him ! it was the 
death of tflwr moft vittoous Gentlewoman that ever Na- 
ture had Praife for creating ; if ihe had partaken of 
riy flefli, and coft me the deareft groans of a Mother, 
could not have owed her a more rooted Jove. 

Laf. 'Twas a good lady, 'twas a godd lady. Wc 
xnay pick a thouland fallets ere we light on fuch aho- 
.therWb. 

Clg. Indeed, Sir, (he was the fweet marjoram of the 
"fillft^' or rather the herb of grace. 

La/r They arc not fallct-herbs, you knave, they 
ire nofe-herbs. 

Clo: I am no great Nebuchadnezzar ^ Sir, I have 
hot muph skill in grafs. . "* ' 

\ Laf. Whether doll thou profcfs thy felf, a knave 
or z fool ? 

Cb. A fool. Sir, at a woman's fervicc i and a 
knavcu at a man's. . . t . . • 

Laj, Your diftindlion ? 

Clo, I would cozen the man of his wl&, and do his 
fcrvice. * ' 

Laf. So you were a knave at hfs fervice, indeed. 

Clo: And I would give his wife my folly. Sir, to 
do htr fervice. 

Lt^. I will fubfcribe for thee, thou art both knavt 
and fool. 

Clff. At your fervice,. 
'* Lafi, N09 no, no. 

f mire ATiVAvt%9 fy t^Kifig^'] A notable Q^lerrftrion tlihP; 
thattfce young Lord ImkI^^ higher 4ifc;/rm'#ir^7 the King bid 
he daid at court, than he was by his beggerly follower Fi^is. 
^c'fliooldread, mon AbviNtAceD, r%.tbii!WflgwOold bave 
T)e^ ^ better tutor to the ta\V young man than Pdhllesi whole prt|. 
•femojj it Was. . ' ■'• ^ -■ T -r ' . r f 



> .■* > 



Oo. 






^// gveB^ that Ends ^IL ^ 93 

CIo. Why, Sir, if I cannot feryeyou* 1'^can.fctyo 
» great a Prince as you are. i /. . 

Laf. Who Y. that, a Frenchman ? 

Clo. Faiths. Sir» he has an ^n;;/^ name ; ..l>Vthii 
\phifiioiny is, more honoured x^ France than ll)^e. ,, 

i^. What Prince is (hat ? 

Of^. The. bUck. Prince, $ir^. dliai the JE^bce^ot 
Darknefi,. ^x.the Devil. . , 

X^. Holdtchoe, there's cny purie ; I give thee, noc 
this CO deduce thee from thy Mailer thou t^k*i^.oi^ 
jcrvc him ftilji^ ,_ 

Oo. ' Pm a woodland feUow» Sir, thatalwa^ 
iQv'd a greait fire > and the.M^r I fpeak of ^ver 
keeps a good fire ; but, fure,' he is the Prince of the 
,i9odd, let his Jfobility remain in*s Court. \ am for 
the Houfe with the narrow g^te, which I ta^ tQ 
he too Utefe.fpcPomp to eq^tf^r; fome, that iHimble 
themfelves, may ; but the many will be too chiU and 
^do*, and^^yMJ be for the Qow'ry way that leadr to 
the broad gate, and the great fire. 

Laf. Go thy ways, I begiqxq be a weary of tbeCi 
and I tell tbcc, fo befori:, bep^ufe I would not fall out 
with thee. Go thy ways, let my horfes be well looked 
K>, without any cricks. 

Ch^ If I p)]t any tricks upon *em, they (ballbej^et* 
tricks, which are their own right by die law pf Na^ 
iHrc. .. \fi}^it* 

z bisthifn&my is man rottbr f« Franoe tiam thn^} This 
is mtolerable nonfenfe. The ftupid Editors, bccaiife t&Q Devil was 
talked of. thought no qaality woald fak him but £«//<r* We 
ftioald read, m^ rg RONOua*0, A joke upon the FriMcb 

people, asiiFthey held a dark iiomplexiop, which it Wfnal to 
iJiei^a ia more eftimatioa thao the Sngiyb do, who are generally 
white and 6ur« i 

3 tm 4- ^fmiUni felkivxy Sir, ScQ.} SbakiJ^iur i$ but raitlf 
goilty of fttch impious tra(h. And it ii obiervable, that then be 
7Xwaj% puts that imo the mooth of hhfiois^ which i| bow grows 
Che charafteriftic of the/'/r#-^#ff//rM«iv. 

Laf, 



Arft A flmwd kna^ei* aiuiban :«nhippjf. 

X^omt. So he is. My Cord«. diM^sigoQe^ oia^ favii»» 
felf much /port oui e$ laAm ; bf bis. audaoricy bo^ro- 
nww fieie^ whioh»hit^tki0kstiA«s» paism l^i^ bis fattd- 
nefsi'aBd^ indeorii he has^m pan, burnias Mitoeibc 

will. 

ZS^ r*lilto biffi* wcii, 'tis' not zm&^i mtdhyms 
about to tell you, fince I hcaid' of tba'^good Ladyi?& 
dtotb', md^ that trry* limd your Son waa* upQR^ his 
murfl^bMiiet Pmov^d theKing, my Mstltor^ to ^cdt: 
inthebehalfof my Daughter ; which, ia^thrminori'!** 
tytof them* b(Mb, his- M»jefty^ out of a fdfi-graGious 
ramfmbraiiees.dldifirft ppopofei' his^ Migbnds. baiht 
prM|is'-dme^ado'it>,- aad^to (top up> th&difpkaifim 
bo'hatfr Goneeiv^d againft your Ion, thoroi is no^fiooEr 
matter. Now«d6'sryoqr Ladjf^fliiplttceiff 

G»$mi. With viciy ayuch contant^ my^Lotd, aod'II 
nvfll k bappily^aeaedi 

' Eaf: HtsMighoefs comes poft>from JlClf^Sifl^i ofi 
as able a body as wheft<botiumbei^d4thistj^;.ho: wtU bci 
hwe'to* morrow, op^I am d^oeiv'dby him that in iikh 
iJnt iHgen oe bath fcktoa^fail'd; 

GcimP^ ^It rcjokes^ mei tbat^bope^ that I (hall ftv 
him ere I die. I have letters^ that' my* foil vmA \m 
iMPManigbc: I ihall befeech your I:K>ndfl!ip{0 remain ^ 
with me^*liH they > meet together* 

ZS»^ Madam, I was thinking with what mannefo«fi 
might fafeiy be admitted. 

Cwnt; TOu need but pkad your hdnourabid privi- . 

Laf% Lady, of that Ihave made a^ bold charter i 
huts' ithank>my Gpd^ k holds ytt; 



4,tItirsfBUiLmiytbM Ih(^lJtmUfieIntrkereI^$i\li ii not 
4l]^itft#Circ|€ioeft.ait)coDe4 out» that that Jiopeif wdl gxpo&dKd 

/a bim ire I dii* v. .^ . . . . 



^Ch. OMadam^ yonda's my |/>txJ; y^jar ^^^ 
a pttctKoB ^nk^^ton^i face^; ^^ifMfaer there^t^ a fi^ 
imder^Cy or noi itte^i^lfiree* know^i t^t- 'tia a goodly 
patch c«*>k)^; ^b-kf^check* it a; cheek of t^o prlc« 
aodahalfi bubhi^ri^^^heek is. worn bare. 

CmmIt Aftai^Mbiy got, or a nobkt fear, b,a .gp^ 
of hondttPc Sk^lootike^ 19 that; 

Cio. 'Bii&i^is^yourcarUnado^d'fiipc. 

ZL^. Let us go (ee your (©», I pray ypix; I'lOpg 
to talk wkh the young nobte fokTier;' 

Cfo. 'Fakh, riiere's a dozen^of' em^ with donate fihcu 
liats and moft oqumous fdacher^, w)iich . bow thp.Hiiftdj^ 
and nod «t«wry man. [Exeunt^^ 

A C T V. S C B N< B Iv 

t 

The Caart »f France, at MacAittto. 1 

« 

£9f/^ Helena, Widaw) otid&aLcm^ m^tWd^Jlfefidifntti^ 

' r 

BUT thi^ estceedihg pofting day. ancl t^t 
Muft wear your fpiritsjow^^ we.caApp( hdj^it 
But fince youVe^q^cJf.thr .days.«atv}. Qk^ts^|OOI?»> 
To wear yovtMQj|jj;lyBbi;iu ,my. a^iw^, ^ ^ 
Be bold^ybftOfttd grp.w,ia nwryreqijitaU 
As nothieg^cjin^.u^rpa jpuk V WHJ^t ^ W^T^p-T ^ 

This man may help me tQ^IysJif ^^ftgr^s e^i^ 

i woww^piyc witli a cambine s arms, which Iiff^jL}f^ h y 4 y"^4y i 




If he woM Ipend hk power. God^&nLjoUt Sir« 
GiKT. Afldiyoa. J i. J ^- 

^W. Sir, I have (ten xm in the qoprt <^ FroMi* 
. G^3K/. I have beefr fofrieckhes ihere;;' 
Ud. I do prefume. Sir, thac you are not fidlen 
From the report chat gCM iqpoii yodr goodnefi i 

Tore, goadfti jritji^moft* ftfUfi occafioni a. i 
nice luaniicrs by,. I put yiNii9. .J^ 
Xhe^uie of your owo virtues, for die wtiipli. 
ribail.)6QQdnue dunkiul. 

.CcRtf. What's yOW will? . :;i. 

" iafrf. That it will pleafe you r . . 

To »ire this poor Mticion jo th( Kiflgi . 
AjiflTatd me with that ftpre of power yflii liave^ 
To copirinto his prefence. 

- (^ta. The King's not here. 

: Vkh Not herer Sir^ 

' Qtnt. Not, indeed. • * ^ * . 

He jhef ce removed laft wf^ and w^ opre tiAfte 
Tlua j&his ufc* . . .. j , . 

,^^. Lord, how we Jofe our pains! ^ 
Bel. MU well^ thai fnds wdl yet, 
Tho^ tiae feem fo adverfe, and oaeans tinflr: 
Ldo befeech you, whdfaer is he gbne?*' 

^Qent. Marry, as Intake it, to RMffiUflh • 
Wfwil\gr Pm goingl " 



• • •• • I 



going. 

M: Sir.' 



Hd. I befeech you^ Sir, '^ 



Sincef^bu are like to fte the King bfcifbrc m^. " '^,p 
Commend this paper (o hia gracious Wd \ ^ 

"^hich, I prefunoe, l!hali render you no blame, ^* 

But 'father make you thank your pafns for it. 
I ^ill <!omt after you wi^h what gQ(|4"ilF^ 
QOrjneans wil{ make MS means. 
;<2ciR&;Xhistild(>^you. - > 

HtL And you Hull find youriUf to be wdi tbanlfd^ 

Go, go^ provide,. ,^; ,: . iv * {Bmam^ 

'.r/ ,^ S C £ N £ 



•'i 






ASt^Ofttt, tktrEnJs ndeff. 97 



r t 



A. 



SCENE II. 

' ■ - 

»■ • • 

£9t€r CIowiH Mil £an>lles. 

Par.^^^O'OD Mr Levatcb^ give my Jjord Lafeu 
VJ thtt ietltr I I have ere now. Sir, been bcctet 
known to yoo^ when I have held fiiiniliarity wkh 
freihcr doachs $ ' but I am now. Sir, muddied in fi}r«i 
timers moat» aiid fmell fomewhac ftrong of her ftrong 
difpicafure. ^ 

Clo. Truly r f^rm^s difpleafafc b bat flottifh^ 'if 
it fmell ti> ftnihgly as thou Tpeak'ft of: I will hence- 
forth cat no fifh of fortune's buttering. Pr'ythce^ 
allow the wind. 

Par. Nay, you need not to fiop your nofe. Sir; I 
ipake but by a metaphor. 

C/^ * Indod/Sh', if your metaphor ftink, I will 
fiop my oofe againft any man's metaphor. Pr'ythee, 
get dice iiirthcr. Par^ 

t hi I 4m- mnvf ^fr, mudMid hi hrtmn^i Mood, it«f fintU 
^mtmd^tMrm^o/iirfiro9gdifplimfnr§^ 1 believe the poet wrote. 
It firfunrs moat ; becauie ttie Clown in the very next fpeech ce- 
fiio» / noitt J b t m i f fhf ^ tat th filh offiftumii buttling ; and again, 
wken he comes to repeat Partlles^s peticioa to La/eut tbaioa/B 
filtit mt9 tbi mncUmm fifhpond tf btr di/fk^fun, and* as it Jays, is 
Maddkd mntM. And^ again,. Prayygu^ Sir, stft the carp at ytm 
ms^. Sec. In dll ^hich places, *tit obvious a moat or pond is th« 
allaiion. Jkfides, Fatbits fmeUing ftrong, as he fays, of fbrtunc*! 
if«iigdifpleaf«re*cwriBi.oo the fiune image; Ibr as the iNmf## roun^ 
eld £us were ahvajrs if pleoifli'd wkh^lh^ Ai the Clown^s joke «l 
holding his nofe^-we pay prefume* procleded from this, thatlbo 
privy was always dver cbe moat ; and tlierefote the Clown ha« 
novrooily iays, when Paniits is preftng him to deliver hk kmt 
to Lord* Lqffih F»iff pr^ibei^ JlsMda^smyt m fafir fi^m fiH^$ 

^ :t»4fgd^ Sir, fjoirmtupipr JM, /^^/i JUf Mf nn^^Oga^fi 
m^ mamsjmUffUi^.} Nothing could be cohceixed with greater ha? 
mOmt^ fnTinftnels of Cuire, than this fpeech. Theuic'dr the 

ypLa. Ill: C H /I ■ 



$^ Alts ny^/?, ihdt Urtii *o)ell. 

Par. Pray you. Sir, deliver, mc this paper. 

Ch. Fob I pr*ythee, ftand away; a paper froiti 
fortune's clore-ftool, to give tq a NpblemaQl look^ 
here he comes hirhfelf. 

£mtr Lafaa. 

Here is a pur of Fortune's, SSr, br fortune*s ca£ 
(but not a mUSK-eat ;) that hath fallen into the nnclean 
filhpond of her difpleafure, and, as he fays, is mfid* 
died withal. Pl^y you, Sir, uft the carp as ycTu may ; 
for he loolcs like a poor^ decay^^ ingtoious, fdolHh, 
^ rafcally. knave. > 1 do pity his dillrefs in ifty fimilie^ 
6f iomifort, ^nd leavf him to your Lordfliip. 

Par. My Locd, I am i man wlioni forttine hith 
^5fu*tly*ftratch*d; , 

*,* Zaf, And what would you have me t^ d6? 'tb^ 
hbei to pare her Qai)s noW. Whifireih havt you i^ay*d 
t^e knave with fortuney that flie flibuld Tcratch vou^ 
^ho of Hcrfelf is a good Lady, and would hot We 
knaves thrive Ibng under her? there's a ^art-d^e^ 
9ft yo<^: let the juftices make yoo and fortune fiiendsi 
1 am for other bufinefs. 

Jlifiking mitafhorihzn oiuAs faidt« whi<h envre ^riHtcnOftCftConi* 
mic. It is not uncommon to fee moral ^daiiacis agaiiift vice^ 

Acfcribe her as Htfiod^ the Fury Trifiitiai ^ 

Upon which £Mr|mKi jtiiUy 6bferv«8, chat, kittaA of giving a imiUk 
image, he hasisimm » vei^ aafty one. Cicfm caotioai well aggM 
k, in his Book deOrat. ^tmiam k^c.hjs^ie, M/kmmmlmms ejli9 
^erhit iramfifenMt mt/ettfkmfMki iV, fmdif'mftpMumJU.fii^tM 
ifi ^mnir tMtpkudk utt^m i^iumy ai quat mtuM mttitm ftti smitum 
irtd^ fimtUtiuh. Nak rnvrig ^d jt/ricatti caAntaa efi rm^th^ 
ccw. N$lo flcrctis cnri^ did 'Ghmeiam. Otir poet himfelf n tx* 
(remelx delicate in this leffea ; who, chrd«ghouv his buge wHtiliQi 
if you exoepc a paibge nrAM^ hat fcardb a mtcaphor ^tmtxA 
cfiend the moft fqaeamilh reader. 



Pi$K. I bpfoech yfNir bonmr) to hear me Que fiagle * 
ironk •'"•.' ''_', *\*^ 

jLs/. Tou beg a lingle penny moro: eomeji ^vl 
Ihall ha't, favc your vnotd. 

Par, My namt,' my good Lord> b Parses. ^ 

Laf. You b^ more than otte vofd then. Coz* 
Qy pafljont give me your hand: how does your 
drum? 

Par. O my good lord^ yop D^ere the firft that 
found ipe. 

laf. Was I) infooth f and T was the firft that Iqft 
Ace. 

Par. It h'es In you, my lord^ to bring me in Ibme 
|caoe» for you did bring me our, 

Laf. Out upon thee, knave! ddft thou put upon 
me at once both the office of God and the Devil? 6^ 
brings thee in grace, iU)d the other brings thee qut» 
^mii 7rsy»r^/jJ Thft Kin^s coming, 1 know, 6y 
bts trumpets. Sirrah, inquire further after me^ I had 
Calk of you latt night ; tho* jyou are a fool and'ii 
khave^ yoiri&all eat^ go to, fo/Io#. 

Par. I pr^ile God for you. [KHmnU 

S^ C E N E m. 

fkurifif. ^^^ I^in& Counters, Lafeg, the tw P^ch, 

Rng. We loft a jewel of her, ♦ our efteem 
tRasjnade much poorer by k ii but your fon. 
As mad in folly, lackM the feflfe u> know 
Ber YftinfiatioA home. 

^Omnt. »Tis paft, my Liege % \ 
4ad I befeech your Majefty lo make it 

• • « ■ • * 

w4 ' «flr e^m], Efitm it li^^fe4 fc ijfimatii/h to ^ 

H 2 Nata- 



]Qo ^Ih nuett, tbat'Bmls'uieJl, 

^ Natural r^bdlioo^ done i*th' bkde of youth. 
When oil and fire, too ftrong for rcafon*s force, 
0*erbear$ it, and burns on. . 
King. My honoured Lady, 
I have forgiven and forgotten all i 
Tho* my revci^s wfrc high bent jipon him, : 
And watch'd the time to (hoot. 

Laf. This I muft (ay. 
But firft I beg my pardon i the young Lotd 
Did to his Majefty, his mother, and his lady, , 
Offence of mighty note ; but to himftlf . ^ 

The grcatcft wrong of all He loft a wifc^ 
Whofe beauty did aiionilh the furvey 
Of richeft eyes \ whofe words all ears took captive |: 
Whofe dear perfcftioo, hearts, that (cornMto fccvei 
; Humbly called miftrefs. : 

King, Praifiiig what is bfti 
> M^kes the remembrance dear. Well — ? call hioi 

hither ^ - 
;; WcVe rccoBcil'd, and the firft view Ihall kill 
All repetition : let hita not ask our pardon. 
^:Th? fl^ure of his great offence is dead, . 
And deeper than oblivion we do bury 
Th* incenfing relicks of it. Let him approach^^ ' 
A (banger, no ofl^ender; and inform him* 
.So *tis our will he (hould. ^ 

'^"C^«/. I (hall, my Liege. ''''-'' • "-- 

King. Whaetfaysheto your danghter? Have you 
-'ipSbc? * • 

Laf^AUi that he is, hath reference to your'Highndk 

5 Naktral rehellion, tkm Vth' b L a o • rfjf9uib,1 The whde fi- 
gure here employ'd (hews we (hould read, 

1 ■■ ■ ■ — — ^ f/h^ »Laz» 9/jouth^ 

i. >- in fervour, flame. So in Trcibu and Creffida^ 

. .« u. ^Ifr H^^Sor* wivVblAaBe ^ wrmth, fiAfirihu 






JCfflff. 



Alfs nuet!, that Ends toell, x'o x 



Kitg. Then (hall wc have a match, ] have letters . 
fcnt me. 
That fct him high io fame. 

SCENE IV. ' 

Enter Bertram. 

Laf. He looks well on*t, 

JCff^i Pm not a day of feafoa, 
For thou may^It iee a fun-fhine and a hail ^ 

In me at ooce; but to the brig^teft beams 
Diftraded clouds give way> fo ftand thou forth»^ ^ 
Xhe time is fair again. 

Ber. My high repented bkunes^ * 

Dear Sovereign, pardon to me.^ 
. Kmg. All i$ whole, ; 
Not one word nK>re of the confumed time, 
Le^s take the ioftaiit by the forward top \ 
For we are o]d> and on our quiick'ft decree^ 
Th* inaudible and noifeiefs foot of time 
Steals, ere We ican eflfedt them. You remember 
The (hu^tter of this Lord ? 

Ber. Admiringly, my Liege. Ac fjrft . _ 

I ftuck my choice upon her, ere my heart . 
Dorft oaake too bold a herald of my tongue : 
Where the impreflion of mine eye enfixing. 
Contempt bis fcornful perfpedive did lend me. 
Which warp'd the line of every other fayoqr \ 
{ ScorcbM ^ ifajr colovu*^ or esfprefsM it ftgirn % 

. fjModed 

r 

6 Sco^N^O a fair coloufy 9r txfrifid itfiolPn\\ firfi^ it is ttt 
be obCcfredy that this youDg man's ^e was not in^iftitn^e to the 
Cez in general, bat a very ilrong attachment to one ; therefore ho 
coold noftfe^n a lair colour, fof it wa& tbac whieh had captivated 
him. Bat he might very naturally be (aid to do what men, fhtmgly^ 
atcach*d to one, commonly dp, not allow beauty in iay h^ bu| 
his miftrefi^s; And that this was the thought here^ is evident. 



To arnoft fii^eoqs object: : thence it capic^ . 
Thatihe, whom all men prak'd, and ^hQA.C9y^^ 
Since I have loft» have lov*d» was in mine eye 
The duft that did offend it. , 

Kin^. Well cxcus'd: 
That thou do'ft love her, ftrikcs Jbme fcores away 
From the great *compt ; but love, that comes tcx> lat^ 
like 4 remorfeful pardon flowly carritdt 
To the great fender turns a fowrc, o^nce^ ^ .- a 

Crying, that's good that is gone: Qttr rafli faiiltii* • 
^ Make trivial frice pf feriou^ thing) wc have. 
Not knowing .thjem» uocil we kii^w their gnavc 
Oft our difpleafuresy to ourselves Vtpjuil» ... / 
Defiroy our friends, Md« after^ vjfisep their duft ; 

I . From the latter part of the veMe» 

^. From t^ ytccflediAg verio, ^' ' 

WbUb vHUf^dtki Jimtff itfffp ^er/nukr *. . i 'h: 

3. From td.^ fofiowing ver(es, 

ExtAidid or ioMiraSiii al/ froforttins 

Sitond^^, It is to be ^riied., ihat h$ defiMt^ lil^Mifctfrtf 
(or jothen in highly figurative expr^ftqus* ' (j^at^amrii^ ftvoOKtyt 19 
fending Urn herpirrpedive-^IaiSy which doa it^oimcc propenf^bjr 
nvarpinv the lines of all other /koes ; by eJmiiim'it (ontraafi^ wm 
- ■ - ^ rttfVildlWtf 



# • -'r 



■ , . ... . — ..^.^. , ,. ,.:tkeipe«* 

phor becomb. xoAx^^ mangled ; but the foifgoing oUervaxion 
will lead us td ^e gbnaine reading, Which is^ 

L #. this |;Iar8 feprdfented the owner as br6«^tt*ortalli9ed; 'or» if 
ituJOp Qiiifed the natiye ^^kmr (p appear artificial. Thus he fppaks 
in chara£ter^ j^id oonfi^iUmtly with the reft of his fpeedu . The 
emendation rcftores loKerjfy to the figure, and, by'a beaudfed 
iboughi^ makes thefi&^^p&JfMnfi of cUtempi do the tsifki^yf 
giumioiflhgitt/t, , '^ 

i JMWr tvMttl ffict of ttfit^i ihUgs — -^ Sirlous br vftlnalAB^ 
III tKisToiie a certain Prcben^ry of Wtfimirjjin i^nderflood fhc.veoni, 
Men he lilSd to tell his friends^ AJhilttn^ was dfiftm$ /^'^{> 

Our 



Our own Jore waking cries to fee whacks douft 
While (hameful hate ueeps out the afternoon. 
Be this fweet Hd£n^% knetl ; and now^ forget hftm ^\ 
Send forth your amorous token for fair M^uH^ 
The aiain conlents are had, and here we'll &^j 
To fee oar widower^s fecond marriage-day : 

Coiaa. Which better than the fir^ Q dear heav'i^* 
' blefi, - 
Or, ere chey meet, in m^ O nature, code! : 

Lrf. Come bn^ my ion, in whom my boufe's wfUS 
Maft be d^^ed : give a favour from you 
To fparkic m the foirits of xpf daughter. 
That (he may qmckly come. By my old beart^ 
And every hair that's on^t, Hdai^ that's dbcad. 
Was a fweet creature : fuch a I'ing as this, 
Tbe laft that ere (he took her leave at opurCy 
I few upon her finger. 
I Ber. Het's it was not. 

J3i|f . Now, ^y you, let nte fee it : For mine 0ye» 
While I was inking, oft was faften'd tp't. 
This ring was mine v *a^ when I gjiv* it fUkUy 
I bad her» if her fortunes ever ftood 
lieodStied to faclp) that by this tok^ 
I would ^Ueve her. Had yoq that f^t |p tcave lie;r 
iDf ' what ihoukl i&ad her rooft ? 

Ber. My .gracious Sovereign^ ■■ -. ./- . . • 

However it pleafes you to take it jb| 
The ring was never hcr*s. 

Qmnt. Son^ on jny life, /^ . 

Tve feeo lier wear ic, iui4 ibc reckoned JC* - 
At her lifers rafi^ 

Laf. Pm fure, I faw \vsc wear it. . 

Ber. You are deceive, nsy Lord, ftift x^et JaW it \ 
In Florence was it frcup a caffiQqit throwo t^e^ . 
WrapM in a paper, which conrainM the nam^ ^ 
Of her that thtew it : NoUe (he was, ' and thought 
I ftood eog^*d \ but when I ha4 fbbf^ib^t^ 

^ H 4 ' To 



«P4 



4^^ 0^ ihift Wnflf t^. 

To mine ^w9,J^ttt|iei't«^4:Hifeite'A:hfn fcHf^ - J 
1 jpij)^fio^ ;3Haft^.it5 that courfr. af . honour V 

As ibe nad made the overture, fhe ceaft 
In heavy fatisEaftiop, at^ would ^evcr 
Receive the ring again. 

JCwr^. Piufus hi0)felf>, : . ^ 

That knows the tinft and muhiplyfng medicine, . 
Hath not in nature's^ Irrfflcry more fcicnceV \ 
Than I have in this ring, • TSS^^as mirn^ *cwas HeJen^f^ 
Whoevor^ave it youf* • then if you knovr, ' \" 

That you arc well acquainted with yourrelf; * * 

Con&fe 'xwas hers^ and by i^hat roujgh enforccmertt [ 
You got ft from her. Shecaird the Saints to furety^ 
That fhe • would ncv^r put h from tiiet ^ngcr, ' ^ 
Unlcls ihe gave it to yburftlf in* bed>i'-' :. . -^ v^ 
(Where you have ncvfcr comej bt fcnl it llS ■ * *; i 

Upon h^ great diidfttr; /' * ' ^\ 

£er. She never few- it. -• • -- >-^ - * 

, King. Thou fpeak'ft it ftffely,' as I Io?t^' lAirte 
honour \ , - ' - -^ 

And nwk*(t ceriieAVar fears to come into tnc, ,.* 

l*'c To — 
deadlj, 
And fee is dead •, whjch iibthing, tiilt to (cfeif 
Her cye« myfelf, couM win me'to'bcHevc, ' I rx 
Mons thin to fee this riftg.'.Talcc hlm^k^f:'".-*" ' 

" ' '-^ ^'[Giiiir^jjJi» Bertram; 
My fore- paft proofs, howe'er tlie matter fall^ 
Shall tax my fears of little vanity, 
Having vainly feared too little. A^ay Mrith ham* 
We'll fift this matter further. *; .. ;. Si 

Ber. If you fhail t)r6vif, ' 

This- ring W^ ever hers, ♦ygu ihall.as eafie « - r;* . 

I, , • ••• • » ' . ^ 

fbaijou are *wili acquainted nvitb ypurfii/A V- f • ^^f?f " y**** 
be wiie. ^Sft'Biatoge ^ay of exprtllin^ fo crimr^^lKmgh)^ ' 

PrpTC 



.-i 



Mt iMfi ifor ISm^ toie%^ #6 j 

Wboe ycr ihe:'i)«vtir inn. - F£4» fieitritt? AAllM 

£j|/«r a GtntUmt. • • '- ^- - ' .. . 

JEui^. Tm wriip'd in difmaltbmkii^. . ^ « 
G^. :Grd^ioufi ^vcEqgn» : - ) 

Wbechcr TvclKcnjtaihiiMneor Jios IknowiMeei 
Here's a petition from a Floren^^ : 
* Who ha^h fojoae 4bar or fiye ranoarea GDme fiMt ' 
Toteodex kljcrielf. I undertook ic» :. : 

Vanqoiih'd tiocffff) b^ the fair gntce and ipeech ^^ \ 
Of the poor fuppliant, who by this, I koofj% 
Is here Wsnding: 'her bu&ieis looks in her '" ^ 

With an imponing vifiige; and^flxe toUme^ i r*^ 
In a fwect verbal brie^ it did ooocem . . 

Xour Highnd^wtdt berfelf.v . l-^ 

The King reads.a letter. ' '. '.; ;.. 

C^Mi ivi^ m^i^ fr^ejiafums tfi marrj ^% vkpi-. Ail. 
fB^^ wfisdedm^J Uujh to [0^ il^^U wn m. . Wm. is 
the Guini RoufiHon a wtdow^^ bis voufs tf/y /i^rfikai 
to mty and m honoufs. foid to bim.^ He fi^fnm 
Fk>i€nc€, tM^ng no Uavc^ (^nd I folhw bim H^ iUsi 
^^^V,/(^ iufticc: irantitm% OMWf inyouithjf 
fyesi otbirvnft a fcMcfr fiourifiKS^ ana a poor maid is 
undone. 

Diana Csipokc. 

Ijif. I will buy me a (bnrin-law in a fair» and toU 
ki him. For this» TU none of him. 

9 mo hatk^9t^%f9Ut or fioiremovii €9mijl^i\ We ihoold 
fcsd, ' Who bmth ^oy^% fiur or fivi ri9mtH oomo Jkori, 
S9 m King iV«r, 

f^r thai 1 am SOMS ttvihf orfmrtUK moo^/kiou 
tag tf m braihir,^^-^^ ' 



V 

To bring forth this difcov'ry. Seek th^le luttors : 
Go fpee^y^ and briog ^in the Couo;. 



Enter Bertram. 

I am afraid » the lite of HcUn (lady) 
Was fouUy (hgedi'd. . 

Cbiatf. Now juftice oadie doers! 

Kii^. I wndar, ^, wivw are fo inonftrous 4o 

you. 
And that yoo Qsf ^m as you fivear to them ; 

Yet you delire to wed. What woomu's chat ? 

Enter TPidm) and 2Maomu 



I am, my Lord» a wr^ehed Floreittme^ 
Derived ^m the ancient Oiipulet% 
My fuit, as I do underftand^ you IcMir, 
And therefore know hoixc.far.I may be pitied* ' ^ : 

fVid. I am her mother/ Sir, wbofe ^e and honour 
Both fuffer under this conipiamt we bring. 
And both fliall ceafe without your remedy. 

IBng. G6me liither. Count} do you know theft 
wometf? 
- Ber. My luord, 1 neitWr can, n'or>*H!, deny 
But that rknow t^em; do -fhey <:harge' me furcW? 

Dkf. Why do you look fo ftrange fipibft ydur wife? 

Ber. She's noncof mine, ^y Lord. 

Dia. If you ihall marry. 
You give away this hand, and that is mine ; 
You. give away hcav'n's VOW89 and thpfe are.jninei 
You give away myielf, which is known mide ^ 
For I by vow ani 10 embodied yours, \ 

That (he, which marries you, (null mvry ^e, 
£ither both « none. 

I^. Ypur reputation comes too ftort fi^ mf' 
daughter, you are no husband for her. TT^ Bertram. 

^ ^--^''ffer. 



^i mt% that Ends tviJk ib^ 

Ser. My Lord, cKis i$ a fend ind de^'mtb crarlinet 
Whom fomi^iine I have kugh'd vridx: let yoiir 

Highnefs 
Lay a more ndbte tfabii^t upon mtae hondirt ' 
Than for to think that I would fink it here. 

E^. Sir for my thoughts, you have them ill CO 
friend. 
Till your deeds gain thens : fairer pnyre yourhtaOur^ 
Than in my thought k lies! 

Dia. Good my lord^ 
Ask him upon his oath^ if lie does thiidc 
He had not my virginity. 

ling. What fay'ft thou to her? 

Ber. She's impudent, my Lord | 
And was a Qoinmon gamefter to the can^. . 

Dia. He does me wrong, my Lord ; if I were ib, . 
He might have bought me at a common price. 
Po not bclieiYc him. O, behold this ring, 
Whofe high rcfpedt and rich validity 
Did Jack a parallel : yet for all that. 
He gave it lo a commoner o'th' can^ 
1/ I be one. , ^ 

CoutU. He 1>Iu{he8, and *ds his.: 
Of fu procedipg ^nceftors, that gemm 
Cooferx'd by iTcftamcnt to th* feouent iffue. 
Hath it been ow'd and worn. This is fais wi^ 
That ring's a thoufend proofs, 

Kif^, Mcthought, you faid, 
You few one -here in Court could witnefs it- 

Dia. I did, my Lord, but loth am to produce 
So had an inftrument ; his name's Parolles. 

Laf. \ (aw the man to day, if nun he be. 

JQff^. Find him, and bring him hither. 

Ber. What of him ? 
He's^quotied for a moft perBdious flave. 
With all the fpots o'th' world tax*d aftd dcbofliM, 
Wlucb nature fickens wkb : but to ^eak truths 

Am 



id8 ^^s^ "O/elfy that Ehds ^aiett. ^ 

Am I or diat or this, fbr ivhat hc*ll utter,/ " 

That. will fpcak any thing P 

'^ King: She hath tnat ring of yours. 

Bfr. I think, (he has ; certain it is, I Iik*d iier^ • 
And boarded her i W wanton way of youth : 
She knew iiendiftanCe,''and did angle for nrie. 
Madding my cagernefs with her reftraint s 
As all impedimencs in fahcy^ courfe 
Arcunotives of more fancy : and in fine. 
Her infuit coming with hei* modern grace, 
SubdoM me to her rate : Ihe got the ring ; 
And I had That, which any inferior njigh^ 
At market-price have bought. 

Dia. I muft be patient : 
You, thattornM off a firft fo noble wife. 
May juftly * diet me. I pray you yet, 
(Since you lack virtue, I will lofe a husband,) . 
Send for your ring, I will return it home^- 
And give me mine again. 

Ber. I have it not. 

Khrg. What ring was yours, I pray you ? 

Dia. Sir, much like the fame upon your finger. 
. Sng. Know you this ring? this ring was his of late. 

Dia. And this was it I gave him, being a-bed« 

Khg. The^ffory then goes falfe, you threw it hUn 
Out ot a cafemeht: ' 

Dia. I have fpoke the truth. 

; ., S C E, N E . VL " ■ 

m 

Enter V^roUcs. 

Ber. My |-^ord, l.dp confcfs, the ring wa« hers. 

You boggle :i(hir^dJy,. every leather ftarts 
y^ulr — rr . 



i ^ s. 



1 T-ViW «i€.*^] /. #..afe ine harlhly^ A plirafe' taken from 
the (even OMthock taken in coring tbp fenpctal diforder. 

r. U 



I 

Aits wfUy that %fkh n«^. i qg 

h this the man yop fpeak $if ? < . < . 

Z)i^. It is, my Lord. 

Kfjig. TcU me^ Sirrah, but tell me true^ I charge 
you. 
Not fearing tne difpleafurc of your mafler. 
Which oh your juft proceeding PIJ keep off 5 
By him and by this woman here, what know you }. 

Par. So pleafe your Majefty, my mailer, h^th been 
an honourable Gentleman. Tricky be hath had In 
him, which Gentlemen have. 

Eng. Come, come, to the purpofe i did he love thii 
Woman? 

Par. 'Faith, Sir, he did love her ; but hpv ? . 

King. How, I pray you ? . { . . 

Par. He did love her. Sir, as a Gentleman loves 
a Woman. 

King. How, is that? 

Par. He Ibv'd her, Sir, and lov'd her not„ , 

iMg. As thou art a knave, and no.kpavci what 
an equivocal companion is this ? 

Par.. I am. a poor man, and at youjr Maj^y's 
Command. 

Laf. Hc*s a good drum, my, Lord, but;a njipghty 
Orator. 

Dia. Dp you know, be promlsM me marri^? 

Par. 'Faith, 1 know more than I'll fpeak^ ' 

King. But wilt thou not fpeak all thou know*ft ? 

Par. Yes, fo pleafe your Majefty. I did go between 
them, as I (aid ; but more than that, he lov'd her : 
for, indeed, he was mad for her, and talked of Satan, 
and of limbo, and of furies, and I know not what 1 
yet I was in that credk with them at that time, that 
I knew of their going to bed, and of other motions, 
as proBPitfing her marriage, and things that woukl 
derive me ill will to fpeak of; therefore I will not 
ipeak what I know« 

King. 



I to Mt <v^y thit Bids vjtU. 

Ki^.^himh^& fpohmM already, uftfefichoucafifft 

fay tl^Y are married ; buc thou art too fine ia cfay 

e^idknct ; therefore Hand afide. This fiagt yoa fay, 

was yours ? 

Dia. Ay, my good Lord. 

I[i9ig4. Where did yoii buy it? or who gare It 

you? 
Dis. It was not given xne, nor did I buy it; 
King. Who fcnt it you ? 
Dia. It was not lent me neithen 
Kv^. . Where did you £ad it then ^ 
Dia* I found it not. 

Kf^. If it were yours by none of all theie ways. 
How could you give it him ? 
Dia. I never gave it htm. 
Laf. This woman's an eafie glove, my Lord, fhe 
goes off and on at pleafure. 

Kifig* This ring was mine, I gava tt his firft wife. 
Dia. It might be yours, cf hers, for wight I 

know. 
Ki^g. Take her away, I do ao^ like her nowi 
To prifon with her : and away with him. 
Vnk& thou teirft aie where chou hadft this ring. 
Thou dieft within this hour. 
Dia. r\\ never cell you* 
King^ Take her away. 

Dia. ril put in bail, my Laege. /. -.^ 

King. I think dliee now ibn^e comtxion caitomar. 
Dia. By /ow, jf ever 1 knew man, 'twas yoa. 
Kmg. Wherefore haft thou accused him all.shis 

while? 
Dia. Becaufe Jie-s gu.iky, and he is not gurlqr i 
He kflows, I am no maid^ and he*ll iwear to^t % 
ril fwear, I* am a maid, . and be knows not. ^ 

Great King, I am no ftruo^t, by my life ; 
Tm either maid, or elfe this old man's wife. 

{P(nnting to Lafeu. 

Kifi/^. 



Mf^ l^p]tMg'$)illk tit 



jKi^. Stvs ddcs abiift our dirs ; A prifoti Wnii>l^» 
' Dia. Good lifioehcr, feith my bail« Stay, roTalSir. 

lExU Widow. 
The jc fre Hc f, that <mes the ring, is fcnt for, • ♦ 
And he (hall furoty me. But fw Ais Lord^ 

Who faath aibusM me, as be knows himleff, 
Tho' yet he irtver battn'd me, here f quit htm* 
He knows himfelf, my bed he hath defilM, 
Am] at that time he got bis wife with child ; 
Dead tho* 6\t be, fhe feds her vourig one' kick: 
So there'a iot riddle ; one, tbac^s dem, is quick:. 
And now bmoH the meaning. 

£iir^ Helena^ W Widow* 

a^. Is ibere no EMrOtt 
BeguiLes iSvt truer oilice of mine eyes ? 
Is^ real, that I fee ? 

Hd. No$ my good Lord, 
*Tis bat a fhadow of a wife you fee^ 
The name, and not the thing. 

£er. Both, both; oh, pardon! 

HeL Oh, my good Lord, when I was like 
maid, 
I found vou wondteus kind i that is your ring. 
And looK yon, hoie's your Idtier: this it fays, 
fFbenfnm myfip^erytm <anget this Hng^ 
Jnd are hy mt tmfb tbild^ &c. This is done. 
Will jrou be mine, now you are doubly won? 

Ber. If Ihe, .my Liege, can make me know this 
clearly, 
PIl love her dearly, ever, ever dearly. 

Hel. If it appear not plain, and prove untrue. 
Deadly divorcee ftep between me and you ! 
my dear mother, do I fee you living ? 

[to the Qmnt^s. 



1 1 f /Utt i»a, tttt Baub -mS. 

Ijf.VGat eyes fmdl oaionv I dull wep ^Qoa: 

So, itnvik thee, «au on me hotne. I'll make fpon 
with thee : let diy couEtcfia alone, they are Iciirvy 
quo. 

JSf^. Let us ftop poiat co ptuot tliii ftory knov. 
To iMke' the even truth in pleafure flov : 
If thou beeft yet a frcfh uxicropped flower, 

[79 Diaoa. 
Chufe thou thy hvsband, and I'll piy thf dower j 
For I can gue&« that, bj thy hondll aid, 
'Hiou kept'ft a wife herfelf, thyfelf t maid. 
Of .tfaataud all the progreTs more and Icfe, 
R^oTvedly more leimre Ihfttl expreli ^ 
All yet Teems well ; and if it end fo me^, 
The Intter paft, morewdaome n thefwaec 



S PI- 



E p I L o G n:% 

Spofcen by the K I N G.' ^ :_, 

- , ■ . 1 tJ' ' '' 

n^HE Kln^tab^ar^ nofo the pUty^Vione: 

All is well 'ended, if tbnfuit be 'vdn, _ 
That you ^^r^^oaiejii-i i/ubk.b tve imttpay^ 
Wttbfiiiff tofUafe you^ day exceeding d^ry ; 
Ourt be your patience tbm^ and yours (Otr parts ^ 
Teur gentle banJs lead w, ami take our hearts. 



Vo£4i. 



riTELFTIb 






1 *■>« jj^ 



-. k 



J i >< 



' •! 




^^r. 



TffE L FTH-NIGH t: 



• ft 



O lU 



WHAT YOU WILL 




- r>'^ 



I 2 



Sebaftian, a young Gentleman^ Brother to V'kAz. 

AMpnjt^ a Searcaptoin, friend to ScbaAiao. r 

Vafenrfne; i ■ , * „ ," ^ , 

_ . \ Gentlemen^ ettaiaittg on toe Duke. 

Sir Toby Betch, Uncle to Olivia. 

Sir AndreV Ague-dice^, a faoli/b Xi^bi^ p-anding 

" •'■rfOnvia. ■ . . . ' 

^7 aet$*cAptiun^ i'ritno to V KHa, ■ — - 
Fabiyi, Servant to Olivia. ^ > '~ 

Malvblio; a fanti^iaU Steward to Olivia. 
ClowHt Servant to Olivia. 

Olivia, a Lady ofgreta Beauty and Tortuntt hehnfi 
bj.tbeXiuie. ... . - - , - 

^arTa; Olivia's Wow^t. 

^ "'^Pfjejiy SaHorif Oncers, and other Attendants. 

X ■ •£ CE.N E, a t-Ciff wf /i&tf ai?/? of Illyfia. . 



r^K^ £ F.TH- 



riVELFTH'NIGHr: 
WHAT YOU WJ^it. 

A c T J. s c E N E^,:t; ^ 

The PALACE,' 
Eia^.;4bt puktt i^inoi ssd Ltrii. ,. - 

D U K I. 

F mufick be cbe food of Iove>. pburooi 
Give me ezcef^of it i ' thac^ fuffcidng 
The appcd^ Love nuy ikkcD, 'abd w 
die. r&U: 

. . * That firain agaui i—it bad « dyiog 

** O, ic Gune o'er my ear, Ii^e the fweec firatb, 

"Thrt 

I — /*«/, fkrfriling 
n*^ffiaUi.m€fjl,Juw, mmdjtdihl That b kB.inpnpricCT 
aTexprefliDn iit [he prcfeut rociing of Uiia fine p*£igc. Wc 40 
Mt &]r, tliM ibi affttiu fiti*Mi mnd Jitt ibr^ mftrful | b« th* 
lul^rA of thai appellee. I un perfoadcd, & wwd it acddoitalljr 
dr^ j and that wc Aoold read, and point, the paflafe ihu, 

thai. fiirfiUiiig 

Jh* 4^'tiu, LowM.mafJStirm, m^fidU. 

S ThMtfiraimt^aUi ithmJm Jjimg/klh 

0! il cmmt t'tr m tar, iHt tbi Jwtt Ji^h 

Is 7lM 




»i8f TwiLfr*r-KicHT: Or, 

•• That breathes upcJti abSink of vblcts, ' 

^^ Stealing, and giving odour. Enoash f^--— ho more i^ 

^Tis not fo fweet now^ as ic was before.' 

O fpim' bf love, hoy^ qokk and frcfli tn tkmf 

That, notwithftandiiig thy capacity > 

Receiveth as iht fea, ncmght erittrs dier^» 

Of what validity and pitch foe^er, I 

Qiit &Us into abatement and low price, ' ''■ 

£ved il"a minufic ; ^ To foil of (hapes ki fidicy, "^ 

That it alone is higlit faqtaftical. 

Cur. 

fkiUireathis upon ^ tank ofwoiitSf 

Sltalii^mfdgMf^mbmr^ — ] A«di^lhe'biMiMi«l 

thi%charmk)9>ii|iip9u£» 'il« ns^ firopriety is J^K l)ie ioaft. Fot 
as a (both wmd, while Uowuig over a Tiolet-baok^ wafts awajr 
th^^d— r ef ihc fl9Wir»,*i^4tf the &at timcy cofninnnifatrt iu 
own fweetnefs to it ; fo the foft afieding mafick^ k^ defcribcd, 
fko* It lakes aWa^ tie ntariPj Av«ec tnuHftiUirf if th&flM; fel; 
at the (ame tube/iCoDoinmiicates a ae^ pkafefiH^ ^ . Or,M 
nay aUtide to ai(iath^ ^goftfttj^^ of fj^ufick^ where^the^ (9^ ^^7 
haTe a power to excite pain or pleafure, as the ftat^ is;; in whi^ 
it find^ the hearer. Hence Miiton makes l&^ ieff^rtme ftniih 
erOf^»i>rap<r td«^te bdili itut aflbateba^ttfaiQiaiidsf^- 
dioly , juft as the mind is jthea difpofe4. If t»^«|iis4u : ^fi^ fif 
fach mufick^ ,; ^ 

. »«/ OrplMatsV/^-W^^^'wfe Jm/ -• 
^ Frgm gclafnjlitmbers fu a aid *• * ' * - 

^' t^&^ ^\i%:u^JtMiri^iaa bur : . i . I / r 
^ SmAfiriunf4r'W9kldhmti^Mf$n^4mi» .. » 

Q^ Pla«H /♦ i&<w« qmitiftifrft , . 

t ; £// Ji^^-^iuaVfiurydioe. L'all^gxo. ''^ 
•* * If to melancholy— ^- 

• ' ' 4?«ri$ m/r/ «/ nvarblii i§ fhijiring^ 

Driw srgn Uars demm Plttto*/ cbuk^ - 
r M4madi Hilfiramt wbmi h^$ didftK 11 pciiferofik 

^* 3 Sb /«// 9fjiafes it/kmy, 

^ ' -^iUitrnhmis ntonjimti^cai.] Tlus complicaiid nmSaik 

licmia be tedified thasi 

iefulLofJhapii m fincf, 

That it along is ni o HT fantafticoi^ 
u #. love is fo fall of ihapes ikfimcy, chat the imm^fttd^ml n 
jpecnliarly given to it ami. 



^.^ 



M^jf(m^^^. ..,7 w^ 



Cur. Will yoiu^gplnmt,' jpjy JU>rd?. , -, ..^ .^^^ . 

C«r. Thehartl Tyv- .- 

Z)«*tf. WJMK fo I do» the nobjeft that I \»xt,; ':,\ 
0, when my. Eyes did fee 'Olma firft, . . / ,/^* ' ' '^ *. -- 
Methought, Ifec purgM the air of jpeftiIeoce;.\ .,/ , 
That inftant was I turned into a hart, * 
And my defires,. like ifell a^id chicl boundst 
E'er finoe pqriiie mc. How now^ what news from her ? 

Enter Valefltine. - * 

Vd. So pieafe my Lord, JLnoight not bejdmitteds 
But fiximiicr haDd^^naid do cetum this aofwqr : 
The etemefit itfelf, 'dU fevM years hence^ 
$hal{ not behold her face at ample view % ^ 
BMt, lilic. a, claylirefs, 0ie will veiled walk> . 
Aod Mtte&oaoeia day hat chaooto* iooikI 
With eye-oflfending brine : all this to feafoa >. 
A brother's dead &ire» which fl^ irouM keep ftdh ' ^ 
ipdr laOing in .her ftil recnepibr^nce. . ^ ; 

Dnh. O^' ^,. thai bach a lieait of chas film frMN^ 
To pay this debt of lof« but ro a brocfaor^ 
How will Ike lore^ when the rich golden fhaft .. 
Hath kill'^ the Bock of all aStiSbions elfe . : 
That live in her? when liver, brato, and heaity . 
^ Three fbv'ragn thrones, are^U fuppiyd, andfilPd^ 
C O fweet per^Uon I) with one felf-iame Kingl 

Bur, for the dd nonfenfe, tht Oo^rd Editor givci .m hk aeW. 

— So full $fjbap0s is fancy ^ 

Ami thm nil oir art Itfgb fantafiical^ Says the Cuiuc^ 

4 THESE fi*ti reign throva—^ Wc ftiould read TttRBB ^'- 
wi^» thrants. This is cxaftly in the manner xsS ShMkiJk$ar. S9» 
Afterwjnds, in iH^^Tty, Tby tMgmt^ ^ fmti, iky liiAu tf^im, 
^nij^irii^ do givi tbei fivefold blaum. 

5 HER /imoii ftfia'ms /] W^ ihottid read, and point ft fhas^ 

I 4 ' Away 



120 T W E L ftT-H.r N I O HJT I Of, 

Love-thoughcs' lye rich, whcft ouKipy':d Afith bmMn. 

S C "E," N E ..rij.,- '.• /' 

* ' ' ' / 

' ' » ■ ■ ^^-f- ' ^ ^ '" *: ''O '' t-' ' ' ' 

^ Tbe^ Street. . ,-. .-i i... . . . ; 

jB»/^ Viola, ^ tf Captain and 'Sailors. . . 

^- Xi/HAT xoimtpj, friends, l^ihis? r 1 
W Cap!llfyria, L^y. A \ 

Vio. And what jthould J[ do in 27/^ ? • v | 
My brother he is in Eljifium. - ■ ■ > ^ • ' .1 

Perchance, he is not drowned ; what thii>k:you> Ailors*? i 

Cap. It is perchance, that you youfJ^if were- &v*d. 

^. O my poor brother ! ib, peccba^c^e, may he Iff. 

Cap. True, Madam ;^ and to comfort you witli 
chance, 
Afiiire yourfelf, afoex our Ihip did f{dk> . ; 
When you, and that boor number far *4 wshryoil* 4 
(Hung on our driving boat : I faw ymr brotbo*, - / ' 
Moil provident in periJ^ bind himfelf 
(Courage and hope both teaching hunihe piafbo^ 
To a ilrong maft, that liv'd upon tM |^i • j 

Where, like Arion on the dolphtn'$ back» 1 

J faw him hold ac(}uaintance with due. wnyes^ 
So long as I could ice^. . ^ . 

Vio. For faying ioy., there's gold. 
Mine own ^fcape unfoMeth to mv hopCy 
Whereto thy fpeech fcrvcs for authority,^ 
The like of him. Know^ft thou this aouptry ? 

Cap. Av, Madam,, well *, for I waa bred^ndfaonlt 
Not three hours travel fron^ this very pUcc*.. t. ^. 

Vio. Who governs liere P. - . ^ • . i 

, Cap. A noble Duke iul nature, as io jNiai6«< . tV 

Vto. What is his name? ^.\^. ^ • . . 

Cap. OrJ^no. 



Fw. OrJb»tnhsivtla2it6rmf iatber hitn^ fein :. 
Hmi^is II ••bftfe'hellMr then. - ' ^- , ^ uJ-j t- i 

v €k^ And lb is now, or was lb very late \ 
Forboc a ouipth ago 1 went frpm henc^ 
Aod then 'tw» freux in niurm&r (as you know. 
What Great ones do, the le(s will prattle of) 
That he did feek the love of fair Othria. 

Vw. What's ihc ? 

Cap. A virtuous maid, the daughter of ii ,^unt. 
That dy*d fotoie twelve months fince, then l^jfmg her 
lo the jprotcftion of his fon, hdr brother. 
Who inortly alfo dy*d •, for whofc dear love. 
They fay, flie hath abjur'd the fight 
And company of men. 

Vio. O, thit I fervM that lady^, 
And might hot be dcHvcr'd to the worH, 
^4111 1-bad Ifiade mine own occafion mello# 
What my eftate is ! ' ' ' . - - 

Cap. That #ere hard to compafs ; 
Becadfe (h(^ will admit no kind pf fuit^ 
No, not the Dtike^s. 

Vio. There is a fair behaviour in thee. Captain \ 
(ftf£l tho* tbatteture with a beauteous wall 
Doth oft cidfc in pollution ; yet of thee, 
I will believe, thou haft a mind that fuits . 

With tbift thy iair and outward chara&er : 
I pr'ythoe, and Pll pay thee bounteoufly. 
Conceal me what I am, and be my aid 
For fuch dilguiie as, haply, fhall become 
The form oi my mtent. I'll fcrvc this Duke \ 
Thott flialr pnelmt me as an eunuch to him» 
Jtmay be worth thy pains ; for I can fmg. 
And (peak to him in many forts of mufick. 
That will allow me very worth his fervice. 
What elfe flnay hap, to time I will commit y 
Only fliape thou tny filcnce to my wit 

Cap, 



123 Tt^ELF^H-NlOHT: Or^ 

Gip: Be you hiseunoch) and your muterti be; :* 
When my tongue blabs, then let miae eyes not lee« : 
Vio. I thank thee s lead me on. [^Etceunt. 

SCENE m. ! 

An j^artment in Olivia'^ II:mfe. 

Enter Sir Toby, and Maria. 

lir T<i. \ 1 7 H A T a plague means nay neice, totake 
VV the death of her brother, tfoa 2 I ant 
fure, ca^e^s an enemy to life. 

Mar. By my troth. Sir toby^ youmttft come inear*^: 
liera-ntghts *, your neice, my lady, takes ^fteatexoepf 
tions to your il 1 hours. 

Sir Jo. Why, let her except, before excepted. 

Mar. Ay, but you mufl: confine yt urfelf wkhin the 
modeft limits of order. 

Sir To. Confine f Vl\ confine mylblf no finerchan I 
am i tfaeie cloat^s are gpod enough ta driok in, and lb 
be thele boots too ; an they be not, let chem hang 
th^mfclves in their own ftraps. 

Mar. That quaffing and drinking, will undo]^ou; 
I heard my lady talk of it yefterday, and of a fdo}i(h 
Knight that you brought in one night hf^re, to' be her 
wooer. 

Sir To. Who, Sir Aadrew Jgue-cbetkf 

Mar. Ay, he. 

Sir To. He's as tall a man as any's m IByria. 

Mar. W hat's that to th' purpofe ? 

Sir To. Why, he has three thoufand ducats a year. 

Mar. Ay, but he'll have but a year vel all thefe du- 
cats : he^s a very fool and a prodigal. •. -i 

Sir To. pie, that you'll fay fo ! he plays o'tb' vW- 
degambo^ . and fpeaks three or ibur langoages word ft(r 
word without book^ and hath all thegpood gifcaof Jigr 

Cure. 

Mar. 



U^at jMi wHl. . • I2J 

Mar. He hath, indeed, -*-alnioftMtuMrifi»r.l>c- 
fides that he's a fooU he's a great quarrcllcr ;. and but 
diat he hath the gift of a coward to allay the guft he 
hath in cpjarreHing, 'tis thought among the prudent, 
be would quickly have the gift of a grave. 

Sir to. By this hand, they are Icoundrels and fub- 
traftors that fay fo of him. Who are they ? 

Mar. They Aat add moreover, he's druak nightly 

in your company. 

Sir Ta. With drmking healths to my pace : PU 
drink to her»as loogas there's a pafTage in nfiy throat, 
and drink in Hbria. He's a coward, and a coyftril, 
dm will not drink to my neice 'till his tHfains >t|3rQ 
crth' «QC. like a jiari(h-top. What, wench? ^Q^Uia^ 
no VoUo ; for here comes Sir JndreWiAgu^-c^eAk^, 

§ C E N E IV. 

r 

: " £«Mr Sk Aadrew. 

Sir Jnd. SitTihyBelcb! how now, StTofyBelcbP 
Sir To. Sweet Sir Andrew ! 
Sir And. Blcfs you, fiiir Ihrew. 
Mar. And yoa too. Sir. 
Sir 3V. Accoft, Sir Andriw, accoft. ' - 

Sir And. What^s that ? 
ir T*. M7 neice's chamber-maid. 



Sir And. Good tniftrcfe Accofit I dcfirc better ac 

qoaiatsnce. 
JMSw. My name is Marfy Sir. / 

Sir And. Good miftreii Mary Apeejt» 



6 <^ftni«iio *«A» }] We flionH xaA voIh. U Emhjb^ wit «m 
TOur C»ftilimH connttnawes that is. jbm. grave, fokmn larfts. 
TktO^d EdiMr bM taken my e«endat«)n t But, by CapbM 
i2/«i,r/, hTfcppofa is ««nt moH era a*d ""ffyJ^J;;- » 
rplain, he laidetftmds gravity and fotmriitf to be «i«iU»jr«* 

eBardiac& -^. ■ «• 






124- TwELfrH-NiGHf: Or, 

Sl^o.^Yon miftake. Knight : accpll) is, front hfer,^ 
boifd W; wooe her, aiBail her. ,1 

sir jSnd* By my troth,! would not undertake her ia 
this coiT^ny • Is that (be meaning of' acciffi ? 

Jlfaf^ Fare you well, gentlemen. '\-uJ 

Sir To. An thou let her part (b. Sir .<^rm^, wo^la 
thou might^il never draw i word agafn, ' , ^ 

Sit Mi. An you pM fo, miftrefi; I Wbuld^l 
might never draw fword again. Fair^l^^y, doj^ou 
think, you have fools in hand ? '" ' ' , 

Mar. Sir, I have not you by thVh^od. 

W And. Marry, but you (hall havc*[ and here's chy 

h/hr. |«Iow, Sir, thought is free: tprajr vou,briftg 
your hand to th* buttery-bar, and let it ^rinJc. 
Sir And. Wherefore, fwect heart ? what's your ih^ 

taphorr ' ;;r '^ : "\ 

Mar. It's dry. Sir. ,.] . -^ , 

Sir And. Why, I tlvfnk fd : I am nbt^fucti an alk. 
()ut I can keep my hand dry. But wW^irydui' icft> 
M^r. A dry jeft. Sir! '^ % ; * *' 

Jiyvferf. Are you fpirof them ? / J . ' 
Afar. Ay, Sir, thkve them at; it)Y fingcrVcnds ; 
marry, now I let your hand go, I anil^^n^en; ,' 

Tl^ Maria. 
Sir to. O KnighJ, ^hbu kck^ftU ?;uj^ pf an»cy,: 
when did I fee the6 fo put down ? ' ^ 

Sir 4nd. Never in your life, I thinl;^ UQ^fs you lee 
canary put me down: iiAethinks, Ibm^loieal bavQ no 
more wit than a bhr^ian, or an ordinary mao has i 
but I am a great eateT of Wf, and, I believe, that does 






harm to my wit. 

Sir To. Noquellio4 

Sir And. An 1. thought that, lUlbrfvoar iL > PIl 
ridit iiome to-morrow^' Sir Tviy. 

Sir To. Pourjuoyy ttty dear KtiJgHt? - ' ^""^ 



' ■* 
k t 



Sir 



W^^ you ^^ ; 125 

JjrjM. W^t,is pourfu^r <^,„or eot,<fe^ I 

f but foiiQwM th6 arts ! . / ; , ,v . , r;^.: - 

SirTe. Then'hadft thou hadiin a«ccllept fe»4 « of 

:^ Sir -/Ari. Why, would th^thavc^mcndcd ojiy Jh^ir? 
I . Sir To JPaft <iueftion J fo^/iKpu fccft, ^>il|.ii6c 

i airlby naturCjV.v \ /,., , ' .V - - 

^ Sir And. But k becomes ,ine yr^ll enough* aojes^c 

^^gir fo^ Excellent 1 Jt hang? like flax pn^.^IUaffj 
toA I hope to ftc a houIe»wifi take thee bet weeq her 
^gs, and fpjn it/)E ... r t ^.- ? ' 

iTir >^. 'Hai% , Vl\ tovf^ .tp-morrow^ Sir. f^^ ; 
j5iir iKicejij;itf nCjt be ^h, pri if fhc be, iCs four to. 
one (hc'n fa<y6i<^''bf me : the Duke himfelf hene^ hkird 
f, wooes her. ^ ^ ^ . r^ 

^ifX^v;?tff^J?P?« o?£h'. Dqk?, AcMl not ipg^ch 
abpvf her ^8rc&. neither in efiate,^ years, nor WH > ( 
have htsur&ha mear it. Tut, there*; life ir>*t, (pan. 

Sir And. rU ftajS; a month |on«n^ I am a fi^llp.w o* 
th'ftnmci^ mind i'ch* worlcj; )!, Relight in masks and 
xtf^ fomietim^ altogether. / ' 
^ Sirjro. ^ tii6u good at theie ktck-fhaws, Kbight ? 
' Sir j^jA$ any.m^n jn Jlhruf;^ whatfoever he be, 
ffm^%'e%g^^ 6f ipy betters ^^ and yet I wirixK 
cofnpare with an old.mani\ '' 
"l^ &r r^. Wtifts thy exccIlckV 




7 tbowfoiftf iinvi// not COOL mt natureJ] We {hooU ltad» if 
nsdilw9i CURL BY m/jrr#. The joke & evident - 

L^i mm^f0^^MM0t^omfar€^iu,idilik^afiM,) Tlib fe SBtOKkd 
as a fiitiA on that common .itetty^. of oidiwcn^ in frdtrriKg Afiir 
owntimei, and thejpft gaiftation^^o the yyrfcnt, 






,Nr 



1 ♦ ' • 

26 TwELFTHJ'NrGHt': Or, 

SirAni. And, I think, I have the bock-tiick, fim^ 
p}y as llrong as any man in llfyria. 

Sir 7i. Wherefore are thefe things hidP wheidbre^ 
have thefe gifts a curtain before them? are they like' 
to tAt duft, like cni(faie6 Malf% pidme ? why tioff. 
thou not go to church in a galliard, aid come homcf 
in a CDfttnto ? mf very walk flK>u]d be a jig I I would 
not fo much as make water, but in a nnk-a^pace : 
wiiat doH thou mean ? is it a world to^ide virtues in f 
I did think, by the excellent conititution of thy leg, k 
was formed under the ftar of a galliard. 

Sir And. Ay, *cis ftrong, and it does indiftnent 
Well in flame-coloar'd ftocking. Shall * we firtabod? 
fome nsreis ? 

Sir 3h. What (hall w^do elie? were we not bbm 
VLndtT Taurus ? . i^ 

Sir And. Tothst^ ^ that's fides and heart. } 

. Sir To. No, $ir, it is legs and diigbs. Let me &i 

Ace Caper J ha! higher: ha, ha N . ' ^m t aeeBentv " 



1 



S C E N E V. 

Changes to the Palacei' , 
Enter Valehtinc, and Viola in matfs Mire. ^ -i 

fW. T F the Duke oondnue thefe favours towards joif^ 
JL Cefario^ you are like to be liiu'ch advanc^dJi^ 
l^e bath known you but three ^ays, a/^d already y oU 
are no ftranger. ^ ' * *! 

yio. You cither fear his humour, or njy neKKgeiic^ 
that you call in queilion the continuance of his 16lr<i|; 
Is he inconftant, Sir, in his &vpurs ? , ^^ ' 

Fal. No, believe me, "* ,, 

' * 

..,,.. £nkr Duke, Curio,; and Attcff^^^s. 

Vio. I thank you : here comes the Duke. 
. '^uke. Who faw Cefario^ hoa ? 



Wha$ ynu nvHi. 127 



Pio, On your attendance, mj Lord, here. 
Duie. Stand you a-while uloaf.—CeJario^ 
Tfaoa know'ft no leis, but all : I have undafp'd 
Tx> thee the book even of my ibcret fouL 
Therefore, good youth, addrefs thy gate unco her $ 
Be not denyM accds, ftand at her doors. 
And cd tlvm, there thy find foot (hall grow^ 
'TiU thott have audience. 

yia» Sure, my noble Lord, 
H ihe be fo abandoned to her jRirrow 
As it is fpoke,' ihe never will admit me. 

Duke. Be clamorous, and leap all civil boukxb. 
Rather than make unproficed return. 
Vio. Say, I do fpeak with her, my Lord ; what then? 
. Htdte. O, then, unfold the paflion of my love, 
Surpri2x her with di&ourfe of my dear £iith ; > 

It (haU become thee well to aft my woes } 
She wiH actead:it better in thy youth. 
Than in a Nuncio of more grave afpeft 
. .JfSo. I think not fo, my Lord. 
Dah. Dear lad, believe it: 
Fol' they (hall yet belie thy happy years. 
That £iy, thou art a man : Diana* s lip 
Is not more fmooth and rubious ; thy fmall pipe 
Is as the maidenfs oi^n, (briti, and ibond, 
^AfiA ^ is fenafalative a woman's part. 
Hfknow, thy Conftellation is right apt 
^£or thb afiair : fome four or five attend him ; 
AH, if you will $ for I my fcif am beft 
^hen leaft in company. Profper well in this^ 
And thou /halt live a$ fi'cely as thy Lord, 
To call his fortunes thine. 

yh. V\\ do my beft 
To woo your Lady i yet, a barrfui ftrife ! 
Who-e*er I woo, my felf would be his wife* {Bfcetmt: 



SCENE 



128 Twelfth-Night: Or, 

s C E N E VI. 

* 

Changes to Olivia'j Hmtfi. 

Enter M«ria ^i Clown. 
Mar. T^ AY, either tcH me where thou haft been, 
xN or I will not open my lips fo wide as a* 
briftle may enter, in wa]f of thy cxtufe r my Lady ' 
will hang thee for thy abfence. . *" 

Qo. Let her hang me; be, that it well hang*d in 
this world, t^s fear ho colours. ^ 

Mar. Make That good. 

Qo. He fhall fee none to fear.^ 

Mmri A good lenten aniwer : I can tell thee where 
that fiiying was born, of, I fear no colours. 

Ch. Where, good mtftrefs Mary f 

M». In the wars ; and that may you heboid to fay 
in yoti fodery. 

Ch. Well, God givtthcm wifdom thathame k ; aiid\ 
th<^ that are fools, let them ufe their talents. * 

Mdsr. Yet you wifl \/t hang'd for bcni^ fo long sibff 
• ienCi of be turn'd away^^ 13 not that « good as iT 
hangii^toyoo? 

' Ck. Marry, a good hanging pre v eutt a bad maiw 
riage ; and lor turning away, let fummo* bear it out^ 

Mar. You are refojote then ? fP 

Ck. Not fb neithef, but I am rcfblvM on two 
points. ^ • 

Mar. That If one ^>reak, the other wiB hold ; or, 
if Both break, your gaskins fall. 

Qo. Apt, in good faith ; very apt : wdl, go thy 
way, if Sir fahy would kave drinking, thou weit as 
witty a piece of £w's flelh as any in Illyria. 
^fu^. Peace, you^Dgue, no more o* that; here 
cornea my Lady ; make your excufe wi£;!y, you were 
bcft. • [ExH. 

SCENE' 



.*■ If^at yeu~^tO» "* 1.29 

S C E N ^ VII. 

• • • 

EMerOliy'iA^ wd Malvolio, -. 

Q0. .Wic, and'c be thy will, put me into a good 
ib6ting \ thofe wus, that* thkilc ihey have ther, do 
fer;^ pfc prove fools ^ and I» chat am ^i]^J^ hck 
clice» may pafa for a wife maa. For what ii^t ^^ 
napaksj Better l;ie a.vitty fool t{iaa a fooUih wUi God 
bfefi thcci Lady ! - , w 

^Qfi^. Take Jth^fbol away. ,,i 

CZ7.'D6 you not hear^ fellow3 i take away tf^-JLady. 

OU. Go to^ /are a dry fooJi Til no va^mof^fiM % 
befides, you'grow diflioneft. , : i^/. 1 

^Ch^ Xwo,^lts> MadoMf that drink tod -good 
oouni^ will jknwnd i for give tlie dry fool drink^,' then 
m the fool not dry :^lBid the di|honeft man on^d him* 
lelC^I ^jbuiffi^ is no lor^ dUbopefi % if hecan« 
DOt^ let' the CKXclJbr mend him. Any thiM» (kit's 

bSt patdi d ifim Jtn i and iinft- that aoicnda, Mbut 




tL^f had o^^jqr 1^ My {tli^rdore^ I%again» 
mZfb. Sir, I bad them take away yiou. 
".C/9. Miforilloo in the higteft d^ee.-^La^, Cn^ 
mJhs nonfadt monacbuni ; 'mat's as much as to fay, I 
wear not aEH)dey if my brain : ^gpod JMadana^ ^ivc me 
leave to prove you a fool. " . . 
Q^^ Canyoudoit? 

Datax>u&]rj gpoSi Mad^is^. 

_ "Mak^: jf6ur proof. . -^ " . ^ .^ ; . ^* 

(. Imuftcat?ccbiz&youforit,4^^ 
b of Virtue^ anlwerme.-. ^^.Z . ^ y ♦ * ^ 
% /Well, Sir, for want of other idlenefs. Til bide 
proof. 
Vol. in. K CU. 



"^ 




» 

130 Twelfth-Night: Or, 

Clo. Good Madona^ ^^^ moorn'ft thou ? 

Olu Good fool, for my brother's death. 

Clo. Ithifik, hisibul isiniiell, Mt^dma. 

OIL I know, his foul is in heaven, fool, 

Clo. The more fool you, Madona^ to mourn iFor 
your brother's foul being in hcav*n : take away the 
tool. Gentlemen. 

Oli. What think you of this fool, Maholio^ doth 
he not mend ? 

Mai. Yes, and (hall do, 'till the pangs of ^eath 
fhake him. Infirmity, that decays the wife, doth ever 
make better the fool. 

Cte. God fend you. Sir, a fpeedy infirmity, for 'the 
better increafing your folly ! Sir Toby will be fwom, 
that I am no fox > but he will not pafs his word for 
two pence, that ybu are no fool. 

Oli. How fay you to that, Malvotio ? 

Mai. I marvel, your Ladylhip takes delight in Tuch 
a barren rafcal ; I faw him put down the othtf ^ay 
with an ordinary fool, that has no more brain than a 
(lone. Look you now, he's out of his, guard already; 
unlefs you laugh and minifter occafion to him». he is 
gagg'd. 1 proieft, I take thefe wife men, that crow 
fo at thefe (et kind of foolsj no better than the fools' 
Zanies. 

Oli. O, you are fick of felf-love, Malvolio^ and tafli|| 
with a diftemper'd appetite. To be generous, guiltleip 
and of free difpolition, is to take thofe things for bird- 
bolts that you deem cannon-bullets : there is no flander 
in an allow'd fool, though he do nothing but rail ; nor 
no railing in a known difcreet man, though he do no- 
thing but reprove. 

Clo. 9 Now Mercury indue thee with pleafing, for 
xhou fpcak*ft weli of fools 1 

Enter 

9 Nonjo Mctcary indue tbee*u;itb tnASTvG,fir tifdu/^eaAyi-nvell 
if fools /] This is a ilupid blunder. We (hoiild read, nniih iplcas- 
ij^(#» #. ^. with eloqucAoe, make thee a gracious aod powerful 

fpeaker. 



r 



tf^f ym "wiiL 1 3 1 

Enler Maria. 



A^r. Madaniy there is at the gate a young Gentle* 
ioan, moch defires <o fpeak with you. 

OU. From the Count Orfinp^ is it ? 

Mar, I know not. Madam, ^tia a fair young M^n^ 
and well attended. 

Ofi. Who erf my people bold him in delay ? 

Mar. Sir TtAtf^ Madam, your Uncle. 

Q£. Fetch him off, I pray you, he fpeaks nothing 
but madman ; fie on him ! Go vou, MahpSoi if it 
be a fuit from the Count, I am ftck, or not at home: 
What you will, to difmifi it. lExii ^LllvoI^o-] Now 
you lee. Sir, how your fooling grows old, and people 
diilike it. 

Ch. Thou haft fpoke for us, Madona^ as if thy 
ddeft Sod (hould be a fool : whole fcuU Jcve cram 
with brains, for here comes one of tliy Kin has a 
mc^ weak £ia MiUer ! ''^^^ 

SCENE VIII. 

Enisr Sir Toby. 
OH. By mine honour, half drunk« What is he at 



p 



kr Ta. A Gentleman. 
OIL A Gentleman? what Gendeman? 

fpeaker» for 3f/rrirr^ was the God of orators as well as cheats. But 
the firft Editors, who dtd not onderiland the phrafe, imtme ibet 
mthfkmjb^, made this foolilh corredion $ more excafable, how- 
e?cr, than the laft £duor*s, who, when this emendation was pointed 
out to him» would make o&<? of his own $ and (6 in hW Oxford 
ed^on; reads, nuitb tBARNiNC ; without troablmg himfelf to fa- 
H/df the reader how the firft editor fltoald blunder in a word (o 
^arff 40 be aaderftoed B^isaruMg^ tho* they wdl might in the word 
fiu^b^f at it 18 nfed in this place. 

K a Sir 



32 Twelfth-Night: Or^ 

Sir to. ' •Tis a Gcntlcman-hcir, A plague xf 

thefe pickle herring! how now, foe? 

Clo. Good Sir Tbfry,— 

Olu Uncle, Uncle, how have you come fo qirly 
by this lethargy ? 

Sir to. Letchery ! I defie letchery : therc*s one at 
the gate. 

Oil. Ay, marry, what is he ? 

Sir to. Let him be the devil and he will, I care 
> not ; give me faith, fay I. Well, it's all one. ^E^. 

Oli. What's a drunken man like, fool ? 

Cfo. Like a drownM man, a fool, and a madman : 
one draught above heat makes him a fool % the fecond 
mads him \ and a third drowns him. 

Oli. Go thou and feek the Coroner, and let him fit 
o* my Uncle ; for he's in the third d^ee of drink ; 
he's drown'd ; go, 190k after him. 

Qo. He is but mad yet, Madona^ and the fool (hall 
look to the madman. {Eant Clounu 

Enter Malvolio: 

Mai. Madam, yond young Fellow fwears he will 
fpeak with you. I told him, you were fick ; he takes 
on him to underfland fo much, and tiierefore comes 
to fpeak with you. I told him you were afleep 1 he 
feems to have a fore-knowledge of that too, and therg 
fore comes to fpeak with you. What is to be fkid m 
him, Xjady ? he's fortified agaioft any denial. 

Oli. Tell him, he (hall not fpeak with me. 

i ^3 mgintlemaiu H£Rf • — ] He ha() before faid it was a 
gentlcnuiL He was a&kisd what gentleman ? and he makes this 
. feplf I which, k is plain, is corrupt, and fliouU be read thus^ 

*Sf?/ a GiMilmum-H si ft, 
i. i, fon^ lady^s eldeft fon juft come oat of the norfery ; Ibr this, 
was the'appearance Fhlif made in mens cloti)ts« See (be fbara^f^ 
fiUMv draws of him preftntly after. 



what you mil. 133 

Mai. He has been told to \ and he fays, he'll ' (land 
ac your door like a Sheriff's poft, and be the fup- 
porcer to a bench, but he'll fpeak with you« 

OIL What kind o'man is he ? 

Mai. Why, of mankind, 

OU. What manner of man } 

Mai. Of very ill manners ; he'll fpeak with you, 
will you or no. 

OU. Of what perfonage and years is he? 

Mai. Not yet oU enough for a man, nor young 
enough for a boy ; as a fquafh is before 'tis a peafcod, 
or a codling when 'tis almoft an apple: 'tis with him 
in ftanding water, between boy and man. He is very 
well-iavour'd, and he fpeaks very fhrewifhly; one 
would think, his mother's milk were £;:arce out of 
kirn. 

Olu Xa hij(Q approach : call in my Gentlewoman. 

M^* ^tndewoman, my Lady calls, [ExU. 

SCENE IX. 

Enter Maria. 

Olu Give me my veil : come, throw it o'er my iaoei 
We'll liaoe noie hear OrJinif% embafly. 

Enter Vipla^ 

Vb. T\» honourable Lady of the hoiifi^ whidi 
ssihe? 

z fiwulMi ffmr dmr likt m Siitifj fofi,'] It vm tke oi«oii ftr 
fhan officer to hfive large /^i (et up at kis door, at an indication of 
hb o«ce. The original of ^hkh was, that the King'5 prod** 
matioDs, and mother pablick aas» might be affixed thereon. by wa/ 
of pnblicatkm* So Jdmfmt E'oify mm mUtflnt hum»mr% 

T§ih LcrdChancMr4tmit^tJ^Shnvt$fem 
So again in the old play called Linguaf 

Kmaw bi b9w t9 htmi fiarltt gtfum, hath he fmh sffi^ 



34 Twelfth-Night: Or, 

OH. Speak to me, 1 fiiall aAfwer for her: jour 
will ? 

yio. Moft radiant, ezquifiee^ and niHBatchable 
Beauty — I pray you^ tell me, if this be the Lady 
of the houfe, for I never, (aw her. I would be loth 
to caft away my fpeech ; for,, befides that it is excel- 
lently well penn'd, I have taken great pains to cod it. 
Good Beauties, let me fuftain no fcorn ^ ^ I am very 
coroptible^, even to the leaft Hniiler ufage. 

Oii, Whence €ame you. Sir? 

Vio. I can fay little more than I have ftudied, and 
tba( Queflion's out of my Part. Good gentle One, 
give me modeft afibrance, if you be the Lady of the 
boi|(^ that I may proceed in my fpeech. 

on. Are jov- a C^omedian ? 

Fio. No, my profound heart ; and yet, by the very 
fangs of matice,. I fwear, 1 am not that I play. Are 
3K>u the Lady of the houfe? 

Oh. If I do not ufurp i!nyfelf, I am. 

f^io, Moft certain, if you are ibc, you do ufurp 
yourfelf ; for what is yours to beftow, is not yours to 
referve; but this is from my Commiflion. I will on 
with my fpeech in your praile, and then Ihew you the 
be^Tt of my liaeflkgc. 

OIL Come to what is important in*t : I fi)fgivc you 
the praife. 

Fio. Alas, I took great pains to ftudy it, and 'tis 
p<^tcal. 

OH. It is the more like to be fcign-d. I pray yott, 
keep k ia. I heard you were iawcy at iny gales ; and 
I aJk>w"d your apptoachi rather to wonder at you than 
to hear you. If you be not mad, be gpnc i if you 
have reafoD,. be brief;, •tis not that tiffie ojf the mow 
with me, to make one in ib skipping a diai^iie. 

fliar. Will you^ holft fail. Sir, here fics^ your way, 

f lam very compttile^'] Cmf title for ready to cal]^ ta aaiount. 



what you ivill. toe 



Ph. No, good fwabber^ I am to hull here a little 
longer. Some molIiScation for your Giant| fwect 
Lady. 

♦ on. Tell me your mind. 

Vio. I am a meflenger. 

on. Sure, you have fome hideous matter to dehVer, 
when the counefie of it is fo fearful. Speak your 
office* 

Vio. It alone concerns your ear. I bring no over- 
ture of war, no taxation of homage; I hold the 
olive in my hand: my words are as full of peace as 
matter. 

OR. Yet you began rudely. What arc you ? what 
would you ? 

Flo. The rudenefs, that hath appeared in me, have 
1 learnM from my entertainment. What I am, and 
what I would, are as fecret as maiden-head ; to your 
ears^ divinity i to any other's, prophanation. 

OIL Give us the place alone. yExit Maria.] We 
will hear this divinity. Now, Sir, what is your text ? 

yio. Moflf fweet Lady, — * 

Olu A comfortable dodlrine, and much may be 
ikid of it. Where lies your text ? 

Vio. In Offin(}% bofom. 

Olu In bis bofom ? in what chapter of his bofbm ? 

Vio. To anfwer by the method, in the firft of his 
heart. 

OH. O, I have read it \ it is herefie. Have you 
no more to fay ? 

4 Via ^^uU Miywr mind^ I am a miffingerml Tfaefewndc 
maSi be divided between the two fpe^^***^ thas, 

Oli. ^ell me your mind. ^ 

Vio. J am a mejfengir. 
Tktk growing thmbldfome, OU'via would drfmifi her, and theiefbie 
cots her flmt with this command, I'iil me your mind. The other 
takiog adyantage of the ambigaity of the word mind^ which fig- 
nifies either hufinefi or incUnafions^ replies as if ihe had ufed it in 
the latter fenfe, I am a mejftnger. 

K4 ^' 



» 



176 TwiLITH-NlGHT: Of, 

Vh. Good Madam, ^ let me fee your &ce. 

Q^ Have you amy commiifion from your Lord tp 
negotiate with my face ? you are now out of your 
text ; but. we will <kaw the curtain, and fliew you the 
pifture. * Look yoa» St, fuch a one I wear this prcr 
fcnt ; is't not well done? C^^^^^r 

Fio. Excellently done, if God did alh 

OIL *Ti& in grain. Sir ^ 'twill endure w^nd and 
weather. 

Pi(t, 'Tis Beauty truly blent, whofe red and white 
Nature's own fw^ and cunning hand laid on:- 
Lady, you are the crudrft She alive. 
If you will iead thefe graces to die Grave, 
And leave the world no copy. 

OH. Q, Sir, I will not be (b hard-hearted : I will 
give out diverfe fcbedules of my beauty^ It (hall be 
inventoried, and every particle' and utenfil kbdi^dto 
my will As, ItM^^ two. Kps incfilferait red* Jtem^ 
two gray eyes, wi&b Mds to them« Jtem^^ one neek, 
one chin, and fo fortiu Were you ient intbor to pnulb 
roe ? " . * • '^ . • 

Vio. I fee you, wkat you are ; you.a|se coo proud i 
But if you were the Devil, you are ftir* .f . 
My Lord and Mafter lovtes yoi^ : O, fich love 
Could be but recompensed, tho* you were oown'd 
The;.!^ii-partil of Beauty ! ' . • - ' 

OH. How does he love me? .^ r . 

Plo. Withadoratipos^ vith fertil? tears, 

... • » 

This is nonfcnfe; we ihbij|d|'caa Iivt^.: The corre^ion, I think, 
dears all up, and gives thle expreflion an Air of Gallantry. Fu^ 
pre(re»n> iee O/Ma'sftw; th<i other kt htngth pulls off her veil, 
and 4*-Xf» **Vf 'wiUdrvm ^ curtain and'fif4fa>you the pifture. I wtar 
this complexion to day, \ jpiky wear another to-morrow; jocularlf 
intimating, that (he £fl/W/ The other, vcxt at Uic jfft, fays, 
ExcelTtitft^ done, if Gtf/drd nfl Fcrliaps it' jniy be true what you 
fay in ]^i\, OlhcrWifc *a8 5ln i^cellent face. ^Tts iftgrmm^Scc. zi- 

With 



IFbat fttt idtt. ijj 

With groott^ that thimderlo^, with flghscTfiriB. 
. OIL Yoar Locd docs know my mind^ ' I cannot 

lone Um- ; 
Ycc I fuppdle him viitnous, know him nobk» 
Qt grcatieftate^ of frdh and Aainleis youth ; 
Id voioes wel| divulged % free, ieu-n'd^ and-^iant \ 
And in dimenfion^ and the fhape of natim^ 
A graciDus peribn ; but yet I cannot love him: 
^e might have took his anfwer long ago. 

Vh. If I did love yoa in my malters 0amc^ 
Widi luch a fuflr^ring, fuch a deadW llfei 
In your denial I would find no fen&r > r 
I would not underftand it. ^' ^ "^ 

Oli. Why» what wodld you do? 

Fio. Make oiea wiHow cabin at yoiff gatcr. 
And call upopisqr foul widrinr tiM hoofe ; 
Vrrkekyflicantd'a of oonaanasd k>v(e^ 
And iiog dxmloud evn in the dead of night: 
Helbwcyonrliame to the fCiwteraie hills. 
An} mafeaUeiablii^ goffip of the air 
Cry our, OHvia! O, yod fliould not reft 
Betwemthe ckmcntt of air^ufd taith^ 
Hat you fliould bity me. . 

Ofi? TottiDig&do much: 
What is y oar |)arentage i 

Vh. Above my fortunes, yet my ttm is well: 
I am a gentlenoan. 

Oli. Get you to your Lord } 
I cannot love him : let him fend no mwe % 
tJnleis, perchance, you cpnie to me s^n, 

rb tell me how he takes it ; fare you well : 
. thank you for'yoqr pains; fpeiid this for me. 
. Fh. I anf no teefd poft, lady i keep your purfe: 
JSij mafier, not myfelf, lacks recompence. 
Love^make his heart of flint, that you fliall love, 
'/Lnd let your fervour, like my mafter^s, be 
^lac'd in contempt! flutwcl, fair crudty. fExit^ 



13$ TwELFTKr^NlCHT: Or^ 

OR. Whatk your paimtage ;, 
uIMe« myfirmnenyet n^Jtate is tevtf :-4— 
I am a gentleman — PJl be fworn tbou art. 
Thy tongue^ tby fece»,.tliy liaai^^ aftions^ and fpirit^ 
Do give diM fi ve*foldr UaaPR*^— not coo &ft — fofi: I 

fokl 
Unlefs thp malkr wers the tnsui. ^— — IJow now ? 
Evei> ibi quickly- oRay one catch the plague? 
Mechinks, I M this youth's perfe£tions» 
With m invifibk and iiibdlc fteakh^ 
To creep in at mine eyes. Well, kt it Jbe**— 
What ho, Maholifi^ 

Enter Malvolio. 

Md. Here, Madam^ at your icnrica 
OU. Run after tbar ianie peevtib meflenger. 
The Duke's vavh ^ he left this rigg behind him. 
Would I, or not : lell him, Til none of it 
Defire him not to flatter with his Lord, 
Nor hold him up with hopes ; I am not for him : 
If that the youth wiU come this way lo-nnorrow^ 
Pll give him reafbos for^t. Hye tiMe» MalvoUo. 
MaU Madam, I will. {EfdH* 

on. I do, I know not whal ; and fear to find 
Mine eve too great a flattereif for my thwd : 
Fatty new thy forec % ourfi^lves wei do not owe ; 
What is decreed, muft be \ and be ^ ib \ {Exili. 




ACT 



what you mtt, j^nn 



ACT II. SCENE I. 

Tie Strebt. 
Enter Antonio Md Seb^an. 

Antonio. 

WILL you ilay no longer ? nor will you not». 
tbat I go with you ? 

Sei. By your patience, no : my ftars ftine darkly 
oirer niej the malignancy of my i^te might, perhaps,, 
diftemper yours ; therefore I ihall crave of you your 
leave, that I may bear my evils alone. It were a bad 
recompcnce for your love, to lay any of thea^ on 
you. 

jlnt. Let me yet know of you, whither you are 
bound. 

Stk. No, footb. Sir ; my determbate voyage is 
meer extravagancy : but I perceive in you fo excellent 
a touch of modefty, that you will not extort from 
me what I am willing to keep in ; therefore it charges 
me in manners the rather to exprefs myfelf : you muft 
know of me then, jtnttmioj my name is Sebaftian i 
wbicb t call'd Rodorigo ; my ^her was tlutt Sebajiian 
of Mejfa&ne^ whom, I know, you have heard of. Hq 
left behind him^ myfelf, and a fifter, both bom in 
one hour; if the heavens had been pleased, would we 
had fo ended \ but vou^ Sir, altered that ; for, fome 
hour before you tooL me from the breach of the lea, 
was my fifter drown'd. 

Am. Alas, theds^i 

Seb. A Lady^ Sir, tho' it was fakl (he much re* 
iembled me, was yet of many accounted beautiful ; but 
tho' I could not ' [with fucn eftimable wonder]] over- 



£4P Twilfth-Night: Or, 

far believe that^ yet thus far I will boldly publiih her* 
ihe bore a mind chat envy could not but call fair : 
flie is drown'd already. Sir, with fait water, cho* I 
feem to drown her remembrance again with more, 

^ni. Pardon me. Sir, your bad entertainment. 

Seb. O %opA4nt6mb^ fprgive me y our irouble. 

Ant. If you will not murther me for my love» kt 
me be yourfervant. 

Seb* If you will not undo wh^t joa have do0e» 
that is, kill him whom you have recovq^d, defu-ie ft 
not, Fare ye wfill at once ^ my boibm i$ full of 
kindners, and I am yet fo near the nunners of niy 
mother* that upon the )ea,fl: occalion more^ mine eyes 
will tell tales of me: I am bound to %\i^ Duke Or- 
Jino^s court \ farewel. \Emi^ 

Ant. The gentlencfs of all the Gods go with thee ! 
I have made enemies in Orfiwf^ court, , 
Elfc would I very (hordy fee thee there : 
But come what may, I do adore thee ib, * 
iThe danger ihall feeni fport^ and I will jgo. \E^i^ 

SCENE «• 

f,nteT Viola ani Malvolio, at frueral doom 

Mai. Were not you e*en now with the Countils 
Olrmaf ^ ^ V' ' ' 

Vio, Even now. Sir; on a moderate pace I hive 
fmce arrived but hither, * . . 

Mai. She returns this ring to you, Sir; you might 
have faved me my pains, to have taken it away your 
ieif She adds moreover, that you fliouid put your 
Lord into a defperate AiTurance, flye Mfill none of 
him. And one thing more, that you be never fo 
hardy to come again in his affairs, unlefs it be to re?- 
port your Lord's taking of this : receive It {o. 

Vio. She took the ring of ipe, TJl none of it.. . 

MaL 



IVhat you mlL 141 

Mai. Come, Sir, you pecviftily threw it to her, 
and her will is, it Ihould be fo returifij: if it be 
worth ftobpihg for, there it lyes in your eye; if not, 
be it his that finds it. iExiS. 

yio. I left no ring with her ; what means this Lady ? 
Fortune forbid, my outfide have not charm'd her I 
She made goo* view of rtic ; indeed, fo much. 
That, fare, mcthought ' her eyes had croft her tongue \ 
For flie did fpcak in ftarts diftraftedly : ^^ 

She loves nfc, fure ; the cunning of her paffiou 
Invites me in this churl i(h meffenger. ' :/' 

None of my Lord*s ring •, why, he fcnt.her ,nc^- 
I am the mart -—If it be fo, (as, 'tis;) 
Fbor Lady, iDhe were better love a dream,, 
Diigctife, I ice, thou art a wickednefs, , . 
Whercrein the pregnant enemy does much. 
How eafie is it, for the proper falfe 
In women's waxen hearts to fet their forms! . 
Alas, oar fndltf is the caufe, not we, '.., 

For feeh^as we are made, if fuch we be. 
How wil^Ms fadg^? my mafter loves her dearly. 
And L poor monfter, fond as much on him ; 
And flie, miffiUcen, ieems to dote on me. 
What will become of this ? as I am man. 
My ftate is delperatc for my mailer's love j 
As I am wpman, (now, alas the day !) 
. What thriftlefs fighs fhall poor OMa breathe?. 
O tigie,. thou ipuft untangle this, not I ; 7 
It is 'too hard a knot for me t' unty. \£mi. 

htr eyes bad )lc|st her f9i^ui,il T^ Vk apnfenle: 



ihoiild rea3» 

f * ' • ■ hir eyes bad CROSt ber i^ngmi 
_ t» dM action of che fiifdnatioAvf the eyesi the dbCboF 
|¥)uch were cailed fr^ng. 



S GENE 



142 Twelpt«-Nioht: Or, 

SCENE Hi. 

Changes to Olivia'j Hbuje* 

£nier Sir Toby, atid Sir Andrew* 

Sir to. A Pproach, Sir Andrew : not to be a*bed af- 
x\ tcr midnight, is to be up betimes \ and 
JXluculo Jurgere^ thou know'ft,— 

Sir And. Nay, by my troth, I know not : but I 
know, to be up late, is to be up late. 

Sir Jo. A falfe conclufion : I hate it, as an unfilled 
can ; to be up after midnightf and to .go to bed then, 
is early ; fo that to go to bed after midnight, is to .go 
bed betimes. Does not our life conlift of the four ek* 
ments ? 

Sir And. Taith, fa they lay ; but, ' I think, it ra- 
Cher confifts of eating and drinking. 

Sir To. Th'art a fcholar, let us therefore tax and 
drink. Maria ! I fay ! — ^a ftoop of wine* 

Enkr Cbwo. 

Sir And. Here comes the fool, i'£uth. 

Clo. How now, my beam ? did yoa never 6e the 
pifture of we three ? 

Sir To. Welcome, als, now let* s have a catch. 

Sir And. By my troth, die fool has an excellent breaft. 
I had rather .than forty killings I had luch a leg, and 
.lb AMeeta breath to fii^, as the fool has. In iboth, thou 
waft in very gracious fooling laft night, when chou 
fpok*ft of Pigr^omitus^ of the Fafians paSRng the 
EquinoAial of ^eubus : 'twas very good, i'faith : I 
fent thee fix-pence for thy Ijemon, hadft it? 

5 li^iiii, itrmthtr cwRftt tf taiinguni driMng!\ A ridicole 
On the medical theory of that time, which fuppofed health to oob- 
fii): in the juft tempenment and balaaoe of theft deoiiQCs in the 
Jiuman frame. 

Oo. 



( 



• fP$at you ^l. 4 ^ t 

'Ch. I did impeticos thy gracillity ; Tor MahoUo\ 
Dofe is no ^ip-ftcx:k. M j Lady lias a whitt band, 
and the Myrmidons are no'bottle-kle houfes. 

Sir And. Excritlent : why, this i& the beft fooling, 
when all is done. Now, a Song. 

Sir To. Cotnc dn, there's Sfihc-pencefor you. Ijct's 
have a Song. 

Sir Jni. Tbere's a teftril df me too ; if one Knight 
pvc a— 

Cle. Would you have. a Love-ibng, or a Sotigof 
good life ? 

Sir To. A Love-ibng, aLove-fi>ng; 

Sbr And. Ay^ ay, I care not for good life. 

Clown fif^s. 

O m^refs miHe^ where are you roamit^-f 

Ofiay and bear^ your true Icfv^s comings 
Tbaicmfii^ hoib high and low. 

Trip no further^ preityJweHii^ \ 

Jeuru^ 4Md tM lover f meettf\gj 
Every v;^\mmCs fin doth htow* 

Sir And. J^oellent good^ I'fHith ! 

Sir To. Good. good. 
Clo. What is iovef *tis not'bireafter : 
Prefent hiinb batbfrefint laughter : 
tybat^s to come^ isftUl mfure ; 

♦ /» decof there iyes no plenty : 

Then come kift me^ fweet^ andtwinty : 
Toutl^s a fluff will not endure. 

'Sir And. AimeHiflaous voice, as lam atnie Knight. 

Sir To. A contagious breath. 

Sir And. Very fweet and contagious, ?faith. 

4 tn Atlzy then lies 99 plenty :'\ Tikis is a proverbial Aying 
corrupted ; and ihould be read thus, 
Im D£CA'Y ibepe ties no plenty. 
A reproof of avarice, which itores up perifhable froits till they eU-- 
^. To tBefe frttits the Poet, hamorouily, compares youth or 
virginity j which, he fays, is tL fluff meill Ǥ/ endtire. 

Sir 



1 




144 Twelpth-Kicht: Or, 

Sir 7k To hair hf the nofe, it k dulcet in conca-^ 
But ihall we make the welkin daace» indeed ? 

tU we roQze the night-owl in ar catch, that will 
s draw diree fouls out of one weaver ? Ihall we do 
that ? 

.- Sir AfU. An you love me^ kt'a dc/t: I ana a dog 
at a catch. 

Q^c' By'r Lady,.Sir, and fooie dm will catch weU. 

fir ^M. Moft ceruin ? let our catch be, ?%0ir ibiMT. 
>0S?« HM iby feacty tbou knave^ Kai|ht. I (hall be 
bonftrain'd in% to call thee knave, Kmghc 

Sir Afd. *Tis not the firft time I have conftrain'd 
one to ^1 me knave.. Begin, fool; it begins, Holi 
thy pe^e\ 

Ch. 1 .(hall never b^gin^ if I hoU my peace. 

SirA»d. Good, i'mith; come, bemn. 

iTbiffifig acatcb. 

$ draw tbrtefwls mu 9f9m wi0v$r f ] ^ Our Aatlior leiacfciiU 
weavers u ihach givca to harmony in his dme* I have fiieim the : 
canfe of it d{ewhere. This exprefiion of Ihe power of aiofak, ii 
^miliar with our Author. Mmcb ad$ Jhwi wurinwg. H&w k' u 
Jmd r4wfAtd. It it m$t firmigi timi Shtffs-'ffasJmU haU /mU «f 
^mtns Miij^-^^ky, he Sy%,fhrii/ouli9 »» becauie he is fpetk* 
mgof a catch in ibriee. parts. And the peripatetic philofophy, thea 
in vogue* very Hberally gsve every man threefools. Thtvegetstroe 
CffUiJHip the mumMil end the ratmuU. Totfais* too, jdmjh 
alludes, in his Futmfiir ; 9fiai, mnll I tum/hMrkt mfvn tHjffiittidt f 
0r mf friends firiindf f IJcom it with with my three foiUs. By die 
nentioa OfthdetJ^eef werefbre, we may fappofe it was Simit- 
j^«r*s pnrpoie/ to hint to as tbdfe iorprKuog efefts of muiick. 
which Oie aatienli fpokof. When they tell bi itfAmfkim^ who 
moved ftoacs and trta i Orpheus and Ariom, who tamed fmvep 
heetfts, and Tumthetu, who governed, as he i^eaied, tSt»paffims 4 
his human auditors. So noble an obfervation has oiir Author coft* 
veyed in |he ribahixy of this buSbon charader • 



SCENE 



• "% 



ffHtat you tif^,' :*•■'" 145 



SCENE IV. ■ . . 

Enter Maria. 

Mar. .What a catterwauling do you keep heref if 
my Lady have not call'd up her fteward, MdvoliOt 
aod bid htm cam you out of doors^ never truft me. 

Sir T0. My Lady's a Catayan^ we are politicians, 
iSaMiQ*tzP»^^Iiamfey^ md^bree merry men be^e. 
Am noc I ooDfiingulobus ? am Z not of her blood ? 
aUy vaUeyf Lady I then dwelt a man in Babylon, La* 
djfy Ladiy. ISingjng. 

Clo. Beihrew me, the Knight's in admirable fooling. 

Sir Jnd. Ay, he does weU enough if he be difpo&'d, 
and fo do I too : he does it with a better grace, but I 
do it more uturaU 

Sir To. O, the twelfib day (fDcctmhcr^ — [Sin^in^. 

Mar. For tke love o*0od, peace. 

u.n 2nter Malvolio^ 

• < • 

ACtfs My mafters, are you OEiad^ or what art you ? 
have>^nowit, manners, norhonefty, but to gabble 
like tihlccrs at this time of night? do, ye niakc an ale- 
hoqle of my Lady's houfe, thai ye fi]ueak out your 
^.cottier3 catches without any mitigation or remorfe of 
voice ? is there no refped of place, perfons, not time 
in you ? 

Sir To. We did keep time. Sir, in our Oitchcs. Snede 
up !— [IRccougbs. 

Mai. Sir Toby^ I muft be round with you. My JLa- 
dy bade me tell you, that tho' ihe harbours yoa as bet 
Uncle, ihe^s nothing ally*d to your diforders. If you 
can feparate vour felf and your mi&lemeanors, you are 
welcome to tne Houle : if not, an it would ploife you 

6 a»iers caichs} Critters. Raftick, dowmfll. 

Vol. in. L 



1^6 TwELf^ap^N!««T: Or, 

16 ^tatf ieive of her, flie is very wMi^g to bid yen 

farewcl. 

- $i^' 9K ParemU ii^ hearty Jma I fnuft needs ke 

gone. 

MdL Nay^ good Sir teiy. 

Go. IHs eyes do Jbn^^ bis Affs are almofi done^ 

Mat ls\ e^tn {of 

Sir To. Bat I will nevtfr die. 

Afe/. iThiS i^ rtiuch credit to pfx. 

ii^rt. SbdUthtdbimgot I iSbigkg. 

' "Go. If^t^ an Ifycu do? 
, i»r jri. Shall I hid Urn go^ and J^ not ? 

aid. 6 », w, »i ywd^ena.- ' ' 

^i^¥i^. Out o'tiinc. Sir, ye Ik : iM^tiioii d^y ixiOA: 
^hm^fteward'^ ttoft rhofi think, bddd&ttiau art vifu 
ta^os, there (hall be Qp morecakel aiid afe? 
• d^. ^es, by ^vscJtmi and ginger iholl be liot 
. iW mouth too. ' 

Sir to. Thou'rt M* righc 6(V dk*, rob your 
chain with crums. A ftoop oF wine, Moiria.'-^ 

Mdl. Miftrife JldRw^, if you prii^nhy l^^dy^ ft- 

votir at tnj xhhig mon; than^^ toDtonpt, tou iTOuld Att 

give iiieinsiwmb^iMi^tt rtikf^ 4he&^ 

by thfe*artd. r - . . . ^j^^ 

A> >l»i. 'Twtre^ good a diet(d(i;tottrm1t wfaena 
Qian's a hungry, to challenge him to -Ihe fieki, «nd 
then to break prtwnfe'wkh him, and make aifool 
-of hiflf). 

^irfi. t>o*t, Kwjght, rilwi-itfethKJfathilteligt: ttr 
Vn delirer thy indignation to himby Word )df ill^dbih. 

Mir. Siwsei Sir fily, ^ be Mriedffereo night i 'fince 
the y*udi of the BtikdSwis to day with iwy Lady, 
ft© is much out of quiet. For Monfieur MalvoSa^ let 
me alone with him : if I do not gull him in^ a nay* 
word, and rtilakehim k common red'cation, do not 
*- think. 






tbink, ths^ wit enough^ lie iftB|^i%.tt)mf»rJiipd< 
I know* I can do.itt :3v.-<- 

Skr S'«u Po|a<» uib |Nfi«f» «<* tf^ wiS^mt^^ of 

i^. hS»3^i Sir, ib(qttimtt J»ira AM d 

j!ir ^J. 6, afl^tboogbt tbaCylMrfaMt bii^^ 
dog. / . ^ ^V'. 

Sir to. Wtbat) dCbr bciiig a £iimtM:l thf «xqQtfiM 
«silcia» xkariKnigbCb 

-^And. I have no exqui0cej»fi3oiMt% bat Uuw 
reafon good enough* - <. ^t 

Mar. ThcimX^Jhmii^fiMh^i^^ 
cooftandy but a tfnoe^pleaier \''9Sk alTe^M^d afi^'thac 
AM ftate.vithpiit book, and utMS it Jby.grotXirtllhs : 
the beft pofnaded of himfelf : fo Cfam'd, jo heihiolNk 
iinthjexttltocto».lbiit.kis,i«s^;i:o^ thacaU 

that look on Uin» lovo him ; indioa that yisk in liiin 
jfiil my icycnge fiod notable caufe to.vprJei. '< * ^ 

Sir Jo. What wilt thou da ? 

HAir. l-fVsUl dvopvinihis vijfUbipejrii&iitieveplftles 
4if IcHTc^ irJHDdiOt bir .the eobuir oClua beards thdilMpe 
«if.bfaleg, the manner of his g^ti^ the txpvo&M joi 
hh eye» forehead^ and compleziofH hefliaJUfijod bini- 
Mf ox>ft feelingly ^perfonated. I can write very like 
my Lady vour Neice ; on a forgotten naatter we can 
.JimUy make diflMAioii.ofvatir.budi. 

Sir Jo. ExcdIenCt I fmell a device. 

Sir j0fd. t ham'c in my nofe too. 

Sir Jv. £kihall think by theletteci). that thpawjlc 
drop, that the]^ oome from^my ^eicc^ and that ihe is 
in love with Juin» 

Sk-jhd. JLnd,yo»ir Jbpri^.iipir wwld iziake h«n 
ana($« .. ,. 

L 2 Mar 4 



1^8 TwELitH-NlGtt*: Or, 

Man A&i Idoubcnor. 
Sir And. O, 'twill be admirable. 
Miir. Sport loyaU I warrant you : I know^ my 
phyfick will work with him. I will plant youtwo, 
*and let the fool make a third, where be fhall find the 
letter : obferve his conftruftion diitz for this ni^t to 
'bt&i and dream on the event. Farewd. [Exit. 

Sir To. Good nighty P^mbifika. 
•' *Sir And. Before me, fhe^s a good wendi. 

Sir To. She's a beagle, true-bred, and one that a- 
^ores me ; what o'that i 

Sir And. I was adored once too. 
Sir To. Let*s to bed. Knight : diooliadft need ftnd ' 
for more mony. ' 

Sir And. If I cannot recover your Neioe, I am a 
foul way out. 

Sir To. Send for money. Knight ) if thou haft ber 
not i*th*end, call me cut. 

Sir And. If I do not, never truft me, take it how 
you will. 

: Sir To. Corner come. Til go bum ibme fick, ^m 
too late to go to bed now : come, Kiug^ i come, 
Knight. lE9ceunt. 

SCENE Vi 
Cbat^es to the Palace. 

Enter Duke, Viola, Curio, mid others. 

Duke. ^^ I V E me Ibme mufick ; now, good mor- 

VJ row, friends : 
Now, good Cefario^ but that piece of fong. 
That old and antique fong, we heard laft night % 
Methought, it did relieve my paffion much ; 
More than light airs, and • rccollcded terms 

t reooHeaed /#f »/] RgailbBfJ, for fitidiedf. 

Of, 



what ^m. 'Will. 149 

OFdiefe moft brisk and ffd^'ftigtd uam^ ^ 
Come, bat one verfe. 

Cmt. He is qot her^ (o plealc yoiir Lordfliip» that 
flKMild fing it. ' 

JDukit* Vfho was hi 

Cur^ Fefie^ the jefter, my Ii>rd» a fool that the La-*^ 
dy OSvia*s father look much delight in. He is about 
thehou& 
. Duke. S^ him out» aad play the tune the while. 

[£ir.. Curio. [Mufick^^ 
Come hither, boy ; if ever diou (halt love. 
In the fweet pangs of it, remember me ^ 
F^ iiich as J 4ip» all true lovers are ; 
Uofiaid and skittiih ^ in all notions elfe, 
Sure in the qcwftaDt image of the creature 
That is belov'dt How doftthou like this tune? 

Vio. ** ' It gives a very echo from the feat 
** Where love is thron'd. 

IMke. Tboo doft fpeak mafterly. 
My Jiie upon't, young tho' thou art, thine eye 
Hatb flaid won ibme favour that it loves ; 

. Ha. A litdc, by your fiivour. 

Duke. What kind of woman is't .^ 

Fio. Qf.your ccanplcxion. 

Duke. She is not worth thee then; What years, i*faith ? 

Via» About yoiir years, my l^rd. 

J>uki. ^* Too old, by heay'n ^ let ftill (he wom^ 
take " 

•* An dder tbw her fdf, fo wcarSr fli? to him 1 ,^ 
^ So fways ihe level in her husban$}'s hoirt.' 
For, boy, however WP do pr^ife oiir felvps,; , ^, 



i» ►.. 



9 nr «// motions el/$^^ The Folio reads nHtons, which is ngjitt, 

1 // ^is<0 vny-uh TO ^^'fi^ - . 

Wb$r€ kvi u tiim^dA We (hoold read/ from tbi fidif. 
;. #. k reaches the throne <» lore^ and reverberates thenct. 

L 3 Our 






150" TwELPtH-N KSrif^: Of, 

Our hocm ire oidre giddy and imfi^ 

More longing, wavering, fooncr kA «nd vofrt* 

Thaft tpmtrts tre. 

P^. I think it well, tny Lord. 

Duke. Then let thy love be yoooger t&m ^j IBf, 
Or fbyaffc^ion cmnot hold the btart : 
For women are is roleS} tibofc fau flower. 
Being once difplay'd, doth fall that very hour. 

Vw. And fo they are : als, diat they aiefo^ ^ 
72>die^ even ntMoi. they to perfedion grow ! 

^Ei^gr Cario and Clown. 

£)»{«. O fellow, come ] the fong we had lift ta^bt^-^ 
Mark it» Ofinio^ it is old sud plain ; 
*f The ^infters and tix \imaxs in Che fiin, 
** AdA die free makis that we^ve their! txtrcAd vvitb 

bonet^ _' ." 

** Da ufe to chant it 1 it is filfy footh, 
** ^ And tallies with the inoocence of love^ 
*' Uketheokl^;e. 

Qo, AfC ^ou ready, BtT 

Duke. Ayi pr'ythtt, fing. [Abfidt. 

, -.,, SONG. 

** ay, (fotfM, 

«« hreatb, 

' enulmad. 

f . fhtti ell mth'ym^ 

*• AW 



-»«* 



• '.' i 



■*. V. 



«* On my tUuk «gn Ut ttfttt hftrom's '"'^ - 
•• NctafmHi^ tui A friend frett '-'" * 

«« My pcor coifs, nifertmjbfMsJMh^irmiL 
«• ^tboi^puUltbMipvtdJigbijofav*^ , ''^ 

** Lay fiu, O / fvSert 
** ^rue lavet mtver ^ud 

** Tove^tbfrt, 

f Ptti^. There's forth vj>ains. 

Cb. No pains. Sir ; I uke pleafiire In fioging^ ^ir^ 

Didce. rll p»]r thy plcafuce tb«it v 

C&L Tiulj^ Sir, and pleafure will be pud ooe (ioie 
orodier« -/ 

Duke. Givie me now leave to leave thieii, li 
CZ0. NowAeoiehmchokGodpffoto&diMbaQdtfae 
tailor inake^ drjr doublet ot efaanesahle uSiSt^ Ibvtby 
mind is ' a vetj Cpal! I would have nm of foph ^pfi- 
ftancy put to iea» ^ that dieir bufinels nugjbic be^veiy 
diii^ and ihor intent no where % for tkMfi jc^ this 
alwajrs makes a good voyage of nothing* JSmm^i 

SCENE YI. 

Vuh. Let all the reft give place. Qooe moct, CSp* 
Get tiiee to yood iameibvotigii cnielty 1. :. 

t « W9 opal !] -A .pfcdoai teia of 4^nqft.aU.^M. 

ST wfi^#i] BochchepicfermisnefcfesMtkiii, Mdttenoo- 
cavcTf «rtke faife, itqsiM^^^ ti w i rttt ad, " '^aarf^My liiMitf 
M wknr. BMutft a mm wiK> Man hinWf ^ xwWidievarjr 
wtady and £> maket his bofindt cvmr wfacre^ cumot be laid to 
immr.MfnMi -fty *y ^^^ *g^gS^ df ii irai iM rinn oftha 
aund to fan^thing.'. Bcndet, the condtmi 
«|»oiit<ifi|oching9 diicftito thii cnebflatioiii 

L4 TcU 




iji 



52 TwELi»TH-NfCHir : Or^ 

Tellher^ myiove^ more noble than the world. 

Frizes ndt quantity of dirty lands % 

The parts, that fortune hath beftowM upon her, 

Tdl her, I hold as giddily as fortune ; 

^ But 'tis that miracle, and Queen of Gems, 

That nature pranks, her Mind, attraAs my iwX* 

Via. But if (he cannot love you, Sk«-^ 

Duke. ^ I cannot be io anfwer'd. 

Fto. Sooth, but you muft. ^ 

Say, th^t fome Ladyt as, perhaps, there is, ' 

Hath for your love as great a pang of heart 
As you have for Olivia : you cannot love her , 
You tell ner fo ; muft ihe not.then be anfwer*d? 

Duke, There is no woman's fides 
Can bide the beating of fo ftrong a paffion, 
tAs love doth-givc my heart : no womar?s"Tieart 
IBa big to hold fo much ; they lack reterition. 
•Alas, their love may be calPd appetite ; 
'No motioa of the liver, but the pa]ate, 
-That fufters furfeit, cfoyment,- and revolt i 
But mine is all as hungry as the iea, 
« And' can digeft as mtrch j make no compare 
Between that love a woman a^n bear m?. 
And that I owe Olivia. 
.. Vio. Ay, but I know— «• 

• - DSkt: What doft thou know ? ' ' ' 

•• ' . 1, » • 

5 But ^tif that mirachy ^W- ^un ofGemt^ \ ' ' 

Thai natun franks her in,*-*-^] What is thai mirach^ aad 
^mnfGms ? wtm iiot.<^ jmMs ladiiig. BisfidMk what ii 
.meaDt by natun f ranking btr imamirmek ^•«— We flxMiU read, 

Bmt ^tis th^Kmi^adh^^ ^S^mj^Qim. 
. . not ma^t^g^a»is, H^^rMmo» — ■ 

i #• what ^ura£^s t>f!^Mk «iapt.4(tiJFVr#wf/, bm hit Hfimi^.tht 
f»j^Af. am4^Vkrf<ifw^y^k^,nM9mpumh, i.e. ietawt»<«id 
^aaor|is^ . • • ..i «i i • . . . r • . "• 



6 lTMeMirir>^9%H0-V>' We moafdred4/i tfce^^Blf 



^fiktin il 






« 



fFhat ;)m ^iH. 153 



Vi$. IViaivdl vhftt love women to men may owe ; 
In fiddi) tbey are as true of heart, B3 we. 
My father faad a daughter lov'd a man. 
As it might be, perhaps, were I a woman, 
I Ihoold your Lordfliip. 

D^ke. And what's her hiftftry ? 

Vio. * AUank, my Lord: Ihe never told her love, 
< But let concealment, like a worm i'th' bud, 
i Feed on her damask cheek : fhe pinM in thought \ 
f And, with a green and yellow melancholy, 
* ' She fat like Patience on a monument, 
^ Smiling nt grief. Was not this love, indeed ? • 

We 

7 She/mi Uh faiiiaei mt a mtMMmmt, 

Smiliwg ta griff ,1 Mr. ^'ik^^/t/fappofes this might pofiUy be 
boroiyed from Cmwat* 

And btr htfdh mjtndtr dtferetlie^ 
Ummi Paoenoe jfiiHwge tbtn 1 find$ 
Witbfmcipaii^ u^nmnbittofftmde. 

b^w mmpfy bus bt rifaid tbmt debt, in beigbtnsng tie ^Burt t Bbw 
mucb does tbi green and yellaw mdancholy tran/ctKd tbi M bird's 
pale face ; H^i nKmiunent bis hill of fand.— — I hope this Crkick 
does not imagiQe SbaktJ^mr meuit to give at a pi&ore of^fmu 
ofPatiimct, by bhgrum smdjiUoiv mslatubofy ; becaoTe, he (ays, it 
tianfoends the piUe/ati of Psaima gircA us by Cbamcer. To tjuow 
Paiiufci into a fit of melancholy, woold be imiced very extra- 
oidinary. The gmm midjilbwtibai bdooeed not to PaHiuctp 
but to ^r who Jki like Fatienci. To ^veratignci a ptUfatu 
was proper: and had 5i^i^«r deicribM i«r, heltoddoneitaa 
Cb4aK£r did. Bat Sbmbi^uir h fpeakiog of a marUe flatae of 
PatitMcti CbrnMeer, c€ Paiiimci haUf. And the two rcprefenti* 
tionsof hcr» are in qoite difimat views. Oar Poet, fpeaking of a 
defpairing lorer, judi c ionily coB y iic s her to Paiiisui exerdftd on 
tlK desith of fiiends sad rebttloof ; iriiich alRuds him the beaoti* 
ibl piSore of Patiinci m m mmsmtai. The old Bard fpeaking of 
PmUtssa hcrltlf, diredty, i|nd not by comparifon, as judiciouily 
diawa her in that drcnmftanoe where ihe Is moft exerdfed, and 
has occafion for all her viitoe i that is to fay» under the hfftt pf 
Jk^msrmk. Ajpt^ now we (ee why Ae is rtpreiented t^ fitting m 
4fm tilttf/and^ to dcfign the feene to be the fea-ihoie. Itis imel^ 
imagined \ and one of the noble fimpiicities of that admirable Poet. 
Bot ihe Critick thoaght« in good eamcft» that XlbM€9r\ inventioa 

wai 



154 TwELPtai-Ni*H»: Or^ 

We mm imy % fiior vfwor 0m«^ bkib i^^ 

Our IhewB arc more than wHl i for ftiU we prcy?*^ ^ ^^ 

Much in our vows, but little in our love. 

Jhtke. But dy'd thy fifker of her love^ my b^ ? 

FiQ. * Tm ill the.daughters of my fit^ier*^ houftt 
And all the brothers too«--and yet I know i)ot-">« 
Sir, IhallltothisLadyf . . f .:; 

X>uke, Ay, that's the theam. ^ 
To her in hafte ; give her this jewel : fay, ^ 

My love can give no place, Ucfe ao demy. [Emmh^ 

s c EN E vn. 

Changes to Olivia*^ Garden. 

£nter Sir Tobyj-iftV Andrew, and F&bian. 

Sir Ta^ ^ O M & thy ways, Signior Fabian. 

. V^ Fab. Nay, Til come ; if I k>le a fcru- 
pie of this iport, let me be boird to death with mehn- 
choly. 

Sir To. Would'ft thou not be glad to have the 
niggardly rafcally ibeep-bitsr come by ibme fiotabie 
ihame ? 

was fo barren* and hts }ma{^tion fe l)q(gkuly>' that he WMiOOt 
able to bs«( die duif^of a snoamiettt for l«a G«dde(a,. JmtM 
her, Ukc a firoU^. finpine i>^l^ spot a |i^ of iaad* 

Jm4^ffihiir0mri H» ■ » j This was the moft artfnl anfwer 
that could be given. The qaeftion was of Ibch t natdre, C^rto 
have declined the appearance of a dhea^tiMer, nrnft tahre mM 
fufpicimi. ^Thiirhai the a^IttOtilcft^^if a di»a aiifwer. th»i th 
fifiitr dieiifhtrkwi ibctHlwh^^wRM-fiuramai^ fiiyiqg, fliewas 
all the daughters of her &ther*s1iottfe. fiut tVe .Ou^r/ Bimor^ a 
great enemy, as (hookf fiSenl> fo» a8 eqatvoe^dh/ obli^ltfti 
nafwerthtts. 

And I Mm ail tbefin s fiat if 1c iho^^^ aiked jW, 

liowtbeDidce caoie to take thitforaHaidfimtD.his qiieftipii» W 
tefaittheBdilor^telli;" •-•*-^^^"-' ''^^^ '- *- 

F^ 



irlR# ^W ^Wif • IKK 

Fak. I woidd enit, mao % yoa kiiow» he bm^gght 
meouc of faTOor wiiii mjr i^idy^ akom a bear-baiting 



^Brt 7*^. Tto aif g^ hftDn nc^U bavacbabaa-qpmii 
and we wiUlbcA kim bhek and biue^ fliaii wc not. Sir 

Sa-Jhl Anwddoaot, ifspicy ofourfifes.^ 

£9/^ Maria. 

<^ ^«r 727, Here comes the licde villain : how now, wjf 
Dctde of /jvifii P 

Mar. Get ye all three into the box-tree i IiMvoM% 
comiqg down this walk^ he has been yonder Pth^ iiui 
pradimig behaviour to his own fliadow this half hour. 
Obfiare nim^ for the love of mockery ; for, I know, 
this Letter 1^ make a contemplauve idiot of him* 
Ctoie, m the name of jefting ! lye thou there \ for here 
cornea the trOut that muft be caught with tickyng. 

\p)rfif»% down a letter^ dnd Exit. 

SCENE Via 

Enter Malvolio. 

M0I. 'Tikbut fortune, all is fi)rtune. Ajhria once 
Md ftie^ Hie did zStGt me 1 and I have heatd her felf 
come thus near, dtttlhouldihe foicy, it fhould be one 
ofmyoomplezion. Befides, fixe on me with a more 
tia^ itdGpCffc, than any erne elfe diat Mows her. 
What fhould I diink on't ? _ 

Sir To. Here's an over-weaning pogue.— — 
. Pa^. O, peace : CDntempktion makes a fare Tor- 
)bey<30ck or him } how he jets under his advanced 
pkimrs! 

1^ Jnd. 'Slifey I Godld lb beat the rogMe, 

-ff^fi^. Peace, Ifay, 

Ji^. To beC<^ MAh^lk^ ^ 

Sir 






156 Twelfth-Night: Or, 

SstTc. Ahf rogue! 
,,Sirjhui. Piftol him, piftol hiai« 

Sir^ Peace, peaoQ. 

Mat. There is example fort : * the Lady of the 
Tracby nrarried the yeoman of the wardrobe. 

Sir Aid. Fie on him, Jezebel! 

Fab. O, peace, now he's deeply \ni look» how 
imagination blows him. 

Mai Having been three months married to hsr^ 



I 



fitting in my ftate 

&ir Ta. O for a ftone-bow, to hit him in the eye! — 

MaL Calling my officers about me, in my branch'd 
velvet gown ; having come down from a day-bed, 
n^here I have left Olivia fleeping, 
' Sir To. Fire and brimftone ! 

Fab. O, peace, peace. 

MaL And then to have the humour of ftate s and 
after a demure travel of regard, telling them, I know 
my ptace, as I would they (hoitld do tbeini-~ to ask 
for my uncle foby- ■ 

Sir To. Bolts and fhacklea ! 

Fab. Oh, peace, peace, peace ; now, now, 

MaL Seven of my people with an obedient ftait 
make out-for him : I frown the while, and, perchance, 
wind up my watch^ or play with ^me rich JQwel* 
Toby approaches, curtHes there to m^. 

Sir To. Shall this Fellow live? 

jpah. * Tho'our filence bedr^wn frpm ys with cares, 
yet, peace. 

Mat. 

m 

9 tkg Lmi^pfthf Strach^] We ihould read Trachy, i. e. Tiracn 
fpr fo i\ito\aEngiiA writers called it. MandttviU^ fa/s, A^Tnchy^ 
and Macfrdoigne of the nvibick AHiandre vjos Kyng" h waa com- 
mon to ufe the article iJbt before names of places: And this was flib 
improper inftance^ where the fcene was in IUfria» 

I Tho^ ourfiUnce he drtrwnfrom us toiih cares,"] i- f. "Jiio* It ts 
the greateft pain to as to keep filence. YttlfitOxftrd Editor has 
altered it to» . • • . ^ . ' 

T^^ ourfilenee he dranjonfrom us by tlf* ears. 

Ihcrft 



Whj$ you mil. i^j 



Mid. I extend my hand to hhn thus ; quenching 
my familiar fmile with an auftere regard of oontroul. 

Sir 1v. And does hot Toly take you a blow oW 
^ then? 

Mai. Sayingi uncle Tdby^ my fortunes having caft 
me on your NeicCj give me this prerogative of 
<peech' 
' Sir 1^0. What, what? 

♦ Ahl. You muft amend your drunkennefs. 
Sir ^0. Out, fcab ! 

Fab. Nay, patience, or we break the iinews of 
our plot. 
Mai. Befides, you wafte the trealure of your time 
I with a foolifh Knight -— -^ 

Sir jfftd. That's me, I warrant you. 
I Mai. One Sir Andrew^^-^^^ . 

^iTiM. Iknew, 'twas I } for many do call m^ 
! Fbol. 

MuL * What^mployment have we here ? 

. \Taldtig up the Letter^ 
> ' A^; Now is the woodoock near the gin. 

Sir To. Oh peace ! now the fpirit of humours in- 
timate reading aloud to him ! 

MaL By my life, this i» my Lady's hand : thefe 
. be her very Cs, her Ws^ and her T% and thus makes 
ihe her g^eac P*s« It is, in contempt of quefl:ion, her 
# hand. 

\ There is fome conceit, I fuppofe, in this, as in many other of his 
iIleratioii9, yet ic oft lies fo deep chat the reader lias reafon to 
wifli he could have explained his own meaning. 

t What tmfh^mini bavi nve btref ] A phrafe of that time, 
eqaivalent to our common fpeech of^-JVhat'^s u do bnt. The Oj^ 
fifi BditoTy net attending to this, alters it to 

What implement bav$ we btn ? 

By which happy emendation, he makes Mal*ooiio to be in the plot 
aeainft himfiufi or l|ow coald he know that this letter was an iwh- 
pumiMt oiade oie of to catch him I 

I Sir And. 



156 TwBLf th^Nich't: Or, 

Sit And. Her C6, Ikt U% and Jier T'g: mhf 

that? 

Mak 1v the akkMrnm UUnfd^ 4bify mid my good 
noi^ \ her very phrafcs: By your leave, waac SlaSA 
,and the imprefliire her Lucrea^ mbk <«rUcb ibc ufis 
to fad ; *ds my Lady: to whom Aould^this be? 

Fciu This wms him, liver and all« 

Mai Jove knows I love^ hn ^bo^ itps do wt4fuw^ 
no man muft know. No man muft ^knoW'-^ ifibAt /dl 
Jows ? the number's alter*d <— no «ao ewft ;kiiow -^ 
4f this ftould be thee, Malvoliof 

Sir fo. Marry, hang thee, Brock ! 

Ma). / may commsnd wb^re I adore^JfUt fiknce^ Mh a 
Lucrece knifc^ 

IHtbMoodlefs ftrokemyifeari^dotbgofe^ h/LO.A.h 
doth Jivay my 1^0. 

' Fvh. A fuftian riddles 

Sir ^0. Excellent wench, fay L 

MaL M. O. A. L doch fway my Ule-H^nn^, bat 
»ficft,H[et mc*fee— — let me fee— — 

Fah. What a difhof poifbn has^flicdfleffdtim? 

SirTo. And wicb what wing 4]ie flMytl cfaccki 
Utit? 

Mai. / may -command where 1 4ukrt. Whff ihe 
may txmimand me: 1 ftrve her, Aie is my Lad^ 
Why, this is-evideat to any •> fomial oapaciiir. Tfane 
is no obftnidtion in this — and the end --« what Aoold 
;6hat alphabetical poGtion portend ? if I CMild make 
-that icionble fomething m me? ibftiyw'-^ildr. Of 
A I. 

^ir^o. 0,ay! make>upthat; keiis«oir«e«aoU 
:C:ent. 

Fab. Sowter will cry upon't for all this, tho* k be 
AS rank as a fox. 

Afo/. M-^Afo/wi^— -^Af. — wliy, Aat b^ns 
my name. ' ■ 

3 jinnial cmfmeUyJ} tytmal, for oomMMu . 

Fak. 



r 



. JM. Dkt»bDl6f, Ik wuld w>tfc it outf die^ur 
is caodknc tx, fiiiilu. 

^ JMb/. M Buc cben dicre is mconionMcy in the 
fequrU IlhiKt^iBfiasB inder piMfattion: ^if iflKmUUM^ 

/"^i. Aod^^iftaUiend, I hape^ 

Sir go. Ay^ or i^Jl ondgd ^lim, aad mafaiB bim 

Md. And then ftoomn behind. 
AA. ilf , raad jmx had mif ejK behind you, ycm 
Kk^iK fliore jdoraAien at yoar tiods than f^Ntunea 

V -JliijC M,0.jI /.^^^ diisiiiiKilation is tiotia the 
femier«~».nd jpettocrafii this a little, k would bow 
«»fM, fa J s itfyoae <>£ idiefe toters is in my aaffiei 
Sd^ herc^aHofCi prdk '-^-^^ If Ms fail itUit^by band^ 
nvokotm In^fiaars lam iAofveJiu^ hut he not afraid 
if\griaitiefs\ fme are iarngmHj feme asebi^w greats 
mefo^ mi'fimeiiave ^atmfsiAmfi mpen ibem. itby 
fates Jtfm 4h6T haads^ iet :% Mood emd /phil embraet 
ibem:i ^midMshmreJiyfotf '^ nAai^bou art Rke ftx he^ 
£aft tfyJmmUe fimm)^ emd^affear fr^. Se oppoftte 
waitb nh^Kam, fii^ mibfervants : kt tby tongue iang 
vipfmenii ofjm^\ pat tbyfelf into tbe trick offmgu^ 
J^% She tbar^ advijes tbee^ thatfigbs for tbee. Re- 
ineawerfobtrifOMnmttdedtllyyBllotpfiida^ andwijb^d 
iofeetbeoi aver tnfs^arterd. - /yiy, remember i go to^ 
iMi art mtde^ ^ ikm dtfa^eft taibe fo : ^ not^ Ut me 
fee Aee afieward ftUlj tbe felkw jof fervants^ and not 
worthy to touch fortunes^ fingers, FareweL Sbe^ . tbat 
mmnld alter fermees ^ with thee^dbe fortunate and bofpy. 
Day-light and champian difcover no more: this is 

4 At/ fimMtadott] BimuUiwif for refeiabhoce. 

^, c ^tk^^i, nf^hmoti^aadJkam dayUf^t ^mi champion 
diftwirs n§ ar^rr: J Wrong pointed : We ^ould read, — w/^ fBei^ 
thefirtunmii and lutpt9^ ^^' ^'/^' '*^ champian di/contir np more : 
i. #. Blosd day aod nm upen countrjr caanot make chingi plainer. 

-^ open. 



i6o TwEL^^H-NiGHf: Or, 

open. I will be proud, I will read politick authors^ 
I will baffle Sir Toby^ I will wa(h off grofs acquain* 
Cance, I will be point devife, the very man. I do 
not now fool myfelf, to let imagination jade mei for 
every reafon excites to this, that my Lady loves me^ 
She did commend my yellow ftockings of late^ flic 
did praife my Iq^, bebg crofs-garter'd, and in this 
ihe manifefts herfelf to my love, and with a kind of 
injun£lion drives me to theie habits of her liking. ^L 
thank my ftars, I am happy : I will be ftrange, ftouf^ 
in yellow ftockings, and crofs-gartet'd, even with the 
fwiftnefs of putting on. Jove, and my ftars be praifedl 
*-« Here is yet a poftfcript. Thou canft tiot cbufe hut 
know who I am ; if thou enteriaineji fnylcpe^ let it a^ 
fear in thy fmUing % thyfmles become thee well. Jiere^ 
fore in myprefence ft'tU fmUe^ dear mf fweet^- 1 pi^j^ 
thee. — Jone^ I thank thee! I will fnule, I will do 
rvery thing that thou wilt have me, [JEMT* 

Fo^. I will not give my part of this fport for a 
penfion of thoufands to be paid from the Sophy. 

Sir 2o* I could marry this wench for this device. 

Sir And. So could I tooi 

Sir To. And ask no other dowry with her, bat fuck 
another jeft, 

SCENE IX. 

Enter Maria. 

Sir And. Nor I nekher. 
Fah. Here comes my noble gull- catcher. 
Sir To. Wilt thou fct thy foot o' my neck ? 
Sir And. Or o* mine either ? 
Sir To. Shall I play my freedom at tray-trip^ and 
become thy bond-flave ? 
Sir And. Tfaith, or I either ? 

SirTo. 



r 



fVhat you nxnU.^^ - ^^ 5t6f 

K- iWhy, thDU httft put him in Tuch a dtiesrm, 

Ifaac when che image of it leaves hixn^ he tholt tuA 

mad. . 'J 

* Mar. Nay 9 but lay tnae, does it workriipon him ? 

^f>. 217. Like Afta ^itd^ wtch a midwifei '^ 

Afar. If you wili thet^i iec the fnihs. of die fport. 

mark his firfl: approach before m^ Lady: he Will 

come to her in yellow ftockings, atid'cis a colour the 

tors % and crofe-garte'r'd^ a /afliion &e detefts \ ixid 
will imile upon Her, which will bow be fo Mm 
zbje to her difpofitipo^ being addifted to a melan-^ 
cboly^ as fhe is, that it cannot but turn him into A 
notable contempt t if fow will iee-it) ibtlpw me. '< 

Sbr To. To the gates of turiari thou moft exdeN 

icntdevilof wici ' ' 

Sir And. V\\ make one too. • {tLHeufd. \ 



^i^^*i****— — — ■ ■ I » %mt 



ACT Hf, SCENE I. 

jE«/^r Viola, i{»»^ Clown, 

lOtA. 

SAV E thee^ Friend, .and thy mofick \ doft thos 
live by Ay Tahoi-f • ' * 

Cfa: 'NdpSir4' i tbre by the Church. 

ViQk Alt thou b Churchman } 

Clo. No £]ch matoer, Sn* ; I do live by the Churdi s 
for I/do live army Houfe, and my Houfe dothftabd 
bythcChuarh. 

Vio. So thou may*fi fay, the King lyes by a Beg-^ 
gar^ if a B^ar dwell near him : or the Church ibnds 
by thyXabor,' if thy Tabor ftand by the Church. 

Vol; III. M Cfc. 



1 6a Twelfth-Night; Or, 

Ch. Tou have iaid. Sir : to foe this age!-~A ieo* 
tence is but! a ' cbev'ril glove to a good wit ; hovr 
quiddy thi; wrong fide may be turned outward ? 

flo. Nay, that's certain ; they, that dally nicely 
with words, amy quickly make them wanton. 
, Clo. I would therefore, my Sifter had had no Nanie» 
Sir. 

• Fio^ Why, Mao? 

. (%. Why, Sir, her Name's a word % and to dalfl^ 
with that word, might make my Sifter wanton ; b^B 
indeed, wordft are very- rafcals, fince bonds di%mcxr 

them. 

Vio. Thy reafon, Man ? 
^Xh* Troth, Sir, I can yield you none without 
words \ and words are gn)wn fo fitlie, I am loth to 
prove reafon with them. 

Vio. I warrant, thou art a merry Fellow, and careft 
for nothing. 

Clo. Not fo. Sir, I do care for fomething ; but, in 
my confcience, Sir, I do not care for you : if tint be 
to care for nothing. Sir, I would, it would make yoo 
invifible. 

Vio. Art not thou the Lady Olivia^s Fool ? 

Ch. No, indeed. Sir ; the Lady OBvia has no folly y 
(he will kcef) no Fool, Sir, 'till (he be married \ and . 
Fools are as like Husbands, as Pilchers are to Herrings 
the Husband's the bigger : I am, indeed, not her Fool, 
but her Corrupter of Words. 

Vio. I faw thee late at the Duke Orjimfs. 

Clo. Foolery, Sir, does walk about the Orb like the 
Sun ; it fliines every where. I would be forry. Sir, 
but the fool ftiould be as oft with your Mailer, as with 
my Miftrefs : I think, 1 f^W your wUdom there. 

Vto. Nay, an thoi^pafs upon me, 1*11 no more with 
thecr Hold, diere's ezpenoes for thee. 

I M thi^^ril glove] A glore made of a kid*8 skin, from ChennreuU 
French. CbiMVinih, Ital. CMfrtlAu, Lat. Mr. /*•/#. 

. . Ch. 



what you nvsff. i6j 

CU. Now fovfj^ fe Ml next commodity of hair, 
fend thoe a boud ! 

Ph. By my trochi FlI' cell thee, I amalmoftfick 
fcr one, aicugh I wo«ild not have it grow oa my cfalo« 
k thy lady ifkhin ? 

CU. Would not a pair ofthefe hatre bred. Sir ? 

Fio. Yes, being kept together, and put to ufe. 

CU. I would play lord Pandarus of Pbrygia^ Sir, 

^^brina a Cr^^^j to this Tr^Ar;. 

^Bi9. 1 underftand you, Sir, 'tis well begg'd. 

^Ck. The matter, I hope, is not great. Sir ; begging 

but a b^gar : Or^da was a beggar. My lady is 

within, Sir, I will confter to them whence you come } 

who yoo ase, and what you would, ii out of my wel* 

kin ; I onghc lay, element ; but the word is over^worri. 

[Exit. 

Vw. This fellow is wife enough to play the fool. 
And, to do that wdl, craves a kind of wit : 
He muftoblerve their mooA on whom he jefts. 
Hie 9«nfty of the perfons, and the time § " 
And, like the hazard, check ^ every fnther 
That comes before Ais eyt. This is a praftice^ 
As fiiU of labour as a woman's art i 
For folly, that he wifely fliews, is fit \ 
But wife naen*s fblly^liiirn, quite taiutt d^ wit. 

SCENE li 

« 

EfOer Sir Toby, and Sir Aodiew. 

I • . » . • ' 

^ SsTy^yl. Save yoo, ga^kman. 

yio. Andyom Sir. 

Sir To. Diiu vcHs punrde^ M^nfiittr. 

Vw. EiVOMsatffii vofhn fervitnir. 

Sir To. Ibope^ Sir» youaiei and I m yom-^ 

a HmthtrpcsdMicaUMdbjMtfMdUL 

Ma Vm 



164 TwELfTH.rNiG.HT: Or, 

.Wjll, yai encounter the fipNfc? tajKigs)^ 19 ^ogroa 

you fhouJd enter, if your trade be to ^. 

.. /¥». I jua ,bopnd to yptfr; jlf ieoe, S^ it I njgu^ fljiC a 

■jbicJlftpfwy voy§ee. . 

Sir To. Tafte your legs. Sir, p^t^ejO) to Q9ockyi, 
Vio. Myl^iS^ bfOKf^ei^utd tat, $k, .i^ I 
underftaod wiujt )^u i;^^ by;tMdding,n;ie|a0((; my 

leg** . - 

^i> yo. I mean, » ^p^; §vr, to ,<»ter.", 

Vio. ItjBiUiap^ijjcr you ^ii;!t|pi(ie 91^ - 

4RC 4tte.ia^ven^. 

. .\ '!^;5ftfr Olivia WMaria. 

M9& pif(:e\^tiA^cxmfiifk*diadf, the -lusasAas lata 
.^^urf^oypftl-. .., ....... 

• .Sir And. That youth's a rare Courtier ! rain odours r 

well. :, ■ . , .. . ■ • . : - 

Vto. Myq^tisr. hath :e9 .«$>!(:& Jatijr, Imt o yottr 
own > tn^^ytm- Md inaw^i^ .«>r. . 

Sir And, 'Q|PW% IjpnegSMtt i»^ youc^ftd *rrtSi 
get 'em^il|(];r^ice«d|L. 

O^, j[ieti(lvgaif]«q)dpor Jk fltut; and levwRtttoioy 
hearing. lExeffi^ Sk Toby^ fir Ao^v,.mid Mam- 




I 



.:^ tiC :E . N B III. 

Give me youj iiand, Sirj - 
^0. My duty^ Madam, and moft humble lervice, 

oii. )W*;Aya«r»ftirie? • ^, r. 

Fio. Cefario is your (ervant^s name, fair Prinods. 

O/i, My fervanc. Sir f* :^va« nevir iMrry^rld, 
Since lowly feigning was call'd compliment : 
Y'are fervanc coiihe Puk& Orptg^ youth. .- 

Vio, And heisvyours, and hemiift Meditie ypdrs; 

i :. OS. 



• > • . 9 



r 




MJi'yoU tvtlL 16.5 

t)li. fi'orhini, T think' liot on hini : for his thoughts, 
*^oald they were blank;, rather than fill'd with tne 1 
Pki, Madam, I come to whet your gentle thoughts 
Onlii^bdialf. 

OU. O, hy yoiit tezvt^ I pray you^— 
I bade you never ^)eak again of Kim, 
Bat would vou undertake another fuit» 
ratheli* ftgar you to follicit That, 
tnudck n-om the iph^res. 

^. Dear lady, i— ^ 

OS. Give me leave, I belecch you : I did ftnd, 
^ After" tht hJk enchantment you did heit, 
A ring, ifi chafe of you. ^o did I abule 
Myfilf, tfiyfcrvant, and, I fear me, you j * 
Under your bard conftruSion nfiuft 1 fity 
To force that on you iii affhameflir Running, ' « 

Which you knew notad of yours. V^hat might yoti 

think? 
Have you not fet mine h6novti it the ftak'e, 
And baitfid it with all th* unmuzzled dioughfs 
Tfat tyhinnous heait cah think f ^ to onetof your M; 
ceiving \ ' . ti . 

Enou^ is' fhewn }' a c^pttis; not a bofbm. 
Hides my pbo( heart, oo kt us he^ y6u' /beak. 

rw. Ipftyifqb. , ' 

OIL That's a d^ree to love. 

yia. Uoy not a gride : for *tis i vdlgar proof. 
That very oft we pity endmies'. 

Oil. Why then, mtfthinks, hii tiin€ to fmilc again | 
O world, how apt the p<)or are to be jproud ! 
If one fhdiild be a prey, how much the biefter 

4 jfftir tie Jaft ntcBAnmM, ydu ^J iitMt,'^ NoiiiSSnft. Itead 
as^ point it tlfo, 

Jft$r tt$ l^ dkbmumtm ym iUYtai, 
s. #• after the enchantment, yoor preienoe worked in my afeft ioai^ 

^ to Mtf ^jmrr receiving] i./. to i)M of jam n^affntuj/lM^ 
She Goniiden him as an arch page. 

^3 To 




l66 TwELFTH-HlGHT; Or, 

To fall before the lion» than the wolf ! {ChckftiHesl 
The dock upbraids me with the wafte of time. 
Be not afraid, good youth, I will not havejrou^ 
And yet when wit and youth are come to harvefty 
Your wife is like to reap a proper man ; 
There lies your way, due weft. 

Vio. Then weft ward hoe : ■ 
Grace and good difpofition attend your ladyfhip ! 
You'll nothing. Madam, to my Lord by me ? 

Olu Stay ; pr*ythee tell me, what thou think^ft 
^nc ? 
' Vio. That you do think, you are not wKt you are. 

OIL If I think fo, I think the fame of you* 

Vio.. Then think you right, I am not what I tm. 

Olu I would you were» as I would JAvi ypu be ! 

Vio. Wottkl it be better. Madam, than I am ? 
I wi(h it might, for now I am your fool. 
' CHi. O, what a deal of ifoorh looka beautiful 
In the contempt and anger of his lip ! 
A murd'rotis guilt Ihews not itfelf more loon, 

Tb^ 'ovc ^^ would feem hid : love*s n^ht is noon* 

^Cifario^ by the roies of the fpring. 

By maid- hood, honour, truth, and every thing, 

I love thee fo, tlmt, maugrc all thy pride. 

Nor wir, nor reafon, can ipy paflion.^ide; 

Do not extort thy reafons from this ctaofir. 

For that I woo, thou therefore haft no cauft : 

But rather realbn thus with reafon fetter ; 

^ove fought is good ; but given, unfought, i$ better. 

^ Vk. By innocence 1 fwear, and by my youth, 

I have one heait, one bofom, and one truth^i 

And that nb woman has ; nor never none 

Shall miftrefs beof it, iave I alone. 

And fo adieu, good Madam ; never more 

Will I my maftcr's tears lo you dq)lore« 



on. 







# 



Whst you ^U. 167 

CMl Tet come igun 1 fisr dioa, perhaps, may^fl: 
move 
Thu Imitt whidi now abbon, to like his Jove. 

[Exeunt. 

S C E N E IV. 

r 

Changes U an Apartment in OUvia'i Hmfe. 

« Enter Sir Toby, if tr Andrew, and Fabian. 
Md. J^ O9 faicb, I'll not flay a jot longer. 
JLN SirTQ. Thy realbni dear venom, 
^ve diy ttsJomm .... 

Ftk. Y€ii moft needs yield your reatfon/Sti^ ""dndrew,. 

Sir Jtnd. Marry, I (aw^your lieke<iW«0H favours 
to the Doke*8 ferving-man, than evtr flietie^w'd on 
me. I fitw*t, i'di* onehafd • 

Sir fa. Did flie lee thet^die while, old &oyi tell me 
that ? rj 

Sir Anii As jdisiif wt fte you now. 

FiA* Tiili was a grett ki^menc of Idvein her to- 
wards you. 

Sir And. *^ght ! wiU yoa make an afi o' me ? 

Fab. I vfSX pnrrt it Mgitimace, Sir, upon the 
oaths of judgment and redbn. 

Sir To. And' they have been Grand Jufy-men fince 
before NotA' was a fiiilor. 

F^. She did fhew favour to the youth to your lighc, 
only CO exafperate you, to awake your dormoufe va« 
lour, to put fire in your heart, and brinrftone in your 
liver. You fhouM then have accoAed her, with fi>me 
excellent jefts, fire-new from the mint; you Aouldhave 
bfng'd the youth into dumbnefi. This was look'd i^ 
at your hand, and this was baulkt. The double gilt of 
this opportunity you let time wafh olF, ^* and you arie 
^ now iail'd into the north of my lady's opinion} 
^* where you will hang like an ifide m a Dutebma^ft 

M 4 • ** bcanl,*' 




1 

I 

1^8 T w E Li J H'^N l«Mt : Or, 

;«< batrd/' qf)le6 jo^tiottimQ k bjr iqfk)C kikfiibia 
attempt, either of valour or policy, f 

Sir Anif, Ah(l'c:b9'8fiy wajr; :it. uxoft .be 'vtioh va*> 
iour i for policy I hate ; I had as lief be a Brtntmifty as 
a politician. 

Sir To. WKy then, build ma thy fortunes upon the 

bafis of valour ; challenge me the Duke's youth to 

figbt With hitn V hurt him in ele^n places ; my n^ 

(hall take note of it ; and afliire thyfelf^ there 

. love-brofccp ih eha vrorid can more prevail in 

commendation with womai) tbato repprt of valour, 

^ah. There is^no w» but this» Sir A9drtw, 

Sirjind. Will either of you bear me a cbailengje to him f 

Sir To. GO) write in a martial handi be curftand 

.Lrlef : it is no matt^ how witty, fo it be eloquent, and 

,tull of invention } taunt him with the licence of inki 

if tliou ibou^Jl him ibme thrice, it ihatl not be tmifiir 

fd as maijy^ lies4Mi will Ijrc m thy Iheet of p^per, al<f 
bugk the'iheet were big enough for the bed of fFare 
in England *, fet 'em down,' go abdut ir. Let there be 
^1 enough in thy ink) tho' ^ho^ write with a goofcv 
pen, no matter ; about it. 
SirJtuL Whm ihalU 4nd you ? 
Sk To. W^;U ^all ihcse at the Qibicuh : ga . 

lExii Snr $fidsc9^ 

SCENE V. 

[ faS. This Is a dear manikin to you^ Sir Taiy. 

Sir To* I have been dear to him, hd^ ^bme two. 
ihoarand,^ix>ng.or ib. 

JPdK Wi.wall h^e z, rye Icftter from him i bm 
.you*Il not ^aeliVer't, 

% ^ir 7i. Never truft me then •, and by all ooeaos ftir 
en the youth to an infwer. I think, oxen and wain* 
ropes cannot hale them tjogaher. For 4ndrew^ if be 
;vere openMji ao^ pu find fo much bk>od in hia^livw 



What you 

«s vBl f^ the ibot of • flejif PU m dn rtflr of 
th* anatomy. 

Fak. And hk ofnxifitBy tbe yokttlH bamii» his ViBtgfi 
DO great picfiige of crtieley. 

5i> TV. t Look, whete the yourigeft i/ncn of niM 
comor. 

il£ir. If you ddli-cf the fpleed, and will hugh yotT;- 

ves into ftkche^ follow mi : yond gull MahoSi ik 

rned Heathen , a very R^negadd i for there is no 

Ihriftian, that means to be fay'd by believiAgr^hd]^ 

can ever believe foch in[ipoffl)]e paflkges of groi&efs. 

He*s in yellow ftockings. 

Sir t0. And crofs-garter'd ? 

Mar. Moft villainoufly ; like a {)edant that keri^s 

a fchdol Pth' church : 1 have dogged him, like his 

murtherer. He does obey every point of the letter, 

that I dropt to betray him ; he dees fmile his face into 

tnoi^ lines dian is in the new m^, with the augtften- 



t6j9 




«nd take't for si great favour. 
Sir To. Come, bring us, bring us where he vL 

.8 C B N E VI. 
Changes /d tbe Street. 

Enter Sebaftian and Antfaomo. 

Seb. T Would not by my will have troubled you. ^ 
X But fince pu ma^e your pleafure of yourpains, 

6 LmI, njtfhire tbi jctagifi wriu of nine eomis.'^ The woment 
parts were then adcd by boyi, fometimes fo Um in ftatore, that 
there wis ocaifibn to obfii^jte 6st impropriety by foch kind of 

I Will 



i^o Twelfth-Night: Or, 

I will no further chide yon. 

.Abit. I could not ftay behind you ; my defi]ie» 
^More Iharp than filed fteel,} did fpor me forth i 
And not all love to ice you, (tho* fb much. 
As might have drawn one to a longer voyage.) 
But jealoufie what might be&l vooraatel. 
Being skilled in thefe parts ; which to a ftrangjer^ 
Unguided and unfriended, oft^n prove 
Rough and unholjpiuble. My willing lore. 
The rather by thefe arguooents of fear. 
Set forth in your purfuit. 

Seh. My kind jintbmioy 
I can no other anfwer make, but thanks i 
And thanks, and {a) ever^chanks ; and oft good turns 
Are fhuflfed off with fuch uncurrent pay ; 
But were my worth, as is my confcience, firm. 
You Ihottid find better dealing : what^ to do ? 
3hall we go ^ fee the rdicks of this town ? 

^, To-morrow, Sir \ beft, firft, go iee your 
• lodging. 

Seh. I am not weary, and *tis long to night ; 
I pray vou, let us ikisfie our eves 
With tne memorials, and the (bings of fame. 
That do renown this city. 

Ant, 'Would, you*d pardon me: 
\ do not without danger walk thefe ftreets. 
Once, in a fea-fight *gainft the Duke his galliefs, 
I did feme fervice, of fuch note, indeed. 
That were I ta'en here, it would fcaroe be anfwer*d. 

Seb. Belike, you flew great number of his people. 

Anti Th* ofience is not of fuch a bloody nature. 
Albeit the quality of the time and quarrel 
Might well have given i|s bloody argument ; • 
It might have fince been anfwer^d in repaying 

7 — fii fbi rfliclM pfihh UmfH /] RtOchf for curiofitiei. 
[ («} — #iiir iimks, Mr- n^id — Volg. tvir ^.] 

What 




r 



tf^t you mU. 171 



What «e tool( baax (ton, whi<^, for tnffick*« ftke^ 
Moil of our city did. Only oiYfelf flood out } 
For wiuch, if I be lapfed iathisplace, 
} (ball pay dear. 
SA. uo not then walk too open. 
Ant. Itdodi not fitme: hold. Sir, hereTs my purle. 
la (he iboth foburbs at the EUfbaa/. 
Ja beft to lodge : I will befpeak our diet, 
^niiles joo fa^iuleyour time, and feed voor knowledge 
^Kth vMwing of the town ; theie Ihall yoa hare me. 
^^&*. Why I your purfc ? 

jfyt. Haraj, your eye ihall light i^poo fome toy 
Too bave ddore to purchaie s and your (tore, 
I think, is not for idle markets. Sir. 
S^. 1*11 be your purib-bearer, and leave yoo for 

An hoar. 

Aia. To th' Elifbant, 

Seb, Idoremeinber. lEttegni, 

SCENE va 

CSuages to 0\ma.*s Houfe, 

Enter Ohvia, end Mara. 

Off. T Have ient after huni ' he £iys hefll owne » 
X How (haU I feaft him ? what beftow on hin 
For youth is bot^t more oft, than bqg'd 

rdw'd. 
I fpeak too loud. 



MakeSe ? heisiad and cml. 

And fuits well for a iervant until my fortunes. 
Where Is MdhtUo t 

8 iefint Utttmt ;] i. «• I fiw** ■«*» ?i^ ■*'} ^ 
tnt b^ comei which Mr. nmbM, aot uadeifiaidiBg, altm 

taUamti kim. 

Mtr* 



172 TwELFtft-Ni6HT: Or^ 

Mdfl He's comings MadSffl^ But in v^efy ftrartgjf 
* manner. 
He is fure poffeft,- M*l4m. 

OIL Why, what's the matter, doe? he fttcf ? 

Mar. No, Madartf- he dott noftfeg but fiflile ; 
yOuf kdyfhip wergfeeit tahatfcforfteguirdibbut you, 
if he come j for, fyre^ the riian is tainted in his wits. 

QIL Go call him K^ther. 




... J£fU0r MahfKAio^ 

Pmas mad as he, . . 

If M arid merry m^dnefi equal be. 

How now, Mafvdiw ? , 

Mai. Sweet lady, ha, ha. tSMes fartt^ually 

On. Smirft thou ? I fcrit fbr thde upon a fad tfc- 
cafion, 

, MaL Sad, lady ? I dOuld be fad ; this does tnake 
fettle obiiruftion in the blood ;* this £rois-gaftefii)g ; 
but what of it ? if it pleaie the eye of One, it is widi 
me as tKe rery true fonnet is : Pleafe one^ andpUdfeaB. 

OR. Why i how doft thou, man ? what is the mat- 
ter with thee ? 

MdL Not black in my mind, tho* yellow in my 
legs : it did cottie to 619 hahds^ alhd c6mmands fliall 
beeseoeutdd. I thiak,- we do know that ^eet ^9*^ 
Hwi hand. 

.CVi. WJItthoi^g0'tob^^ Jb&ijfriitt/ 
Mai. To bed? ay, fwcet heart s'afid PU come to 

thee. 

OIL God cottiforl thee ! why doft thou fihilc fo, 
and kiis thy haiid fi^oft ? 

Mar. How do you, MahoUo i 

MaL At your requeft ? 
Yesy nightingales aafwer daws \ 

Ma^. Why appat* ytou widi this ridiculous bbldndk' 

before my lady r 

. Mai Be not afraid of Grcatnefi j— 'twas well writ. 

OIL 



: . }f^4t you w/Z. 1 73 

4^, yth9t. «mi)# thou by clpai, Mflh^ 9 
j^j, Sqiik: af!e bpirii Gk4&**<'-wp. 

^d/. Aod f^me baye Gmcoi^ fhmft upooi thim 

^^•. |l¥ai^/» wft«« thee I 

lifdt .Ee$9csabcr> vbo ceamMndod thy y«U« 



i«p 



45fc?f, Thy y^lov ftockiogs ^ 

JM^. An4 wifliM tx) fix 1^ €mis-garier^d r^ivi 

OIL Crofe-g^er*d ? 

Mai. Go to, thou art made, if thou defircft to bq 

fi> ■ ■ ■ ■ 
Oli. Am I made ? 

ilftf/. If flor, kt me 6e tl^ a iervant ftill. 
p/i. Why» this is a very midfummer madne&s 

£ff(^5enrant« 

Ser. Madam, the yopng gentleman of the Dt&c Of- 
//itf's is returned ; I could hardly cptrcat him bstck; > 
lie attends your ladylhip's pleafuir, "- 

on. ril come to him. Good Maria^ let this fellow^ 
be look'd to. Where's my uncle Tabyf let fome xinff 
•people have a fpecial care of him > I would not have 
'ftim mifcarry for half of my dowry. iEmU 

S C E N E VIII. 
- 'J£i/.Ofa,ohldoyoucomeaearmenow?noworik 
man than Sir Toiy to look to met. this concurs direft* 
ly with the letter^ flie fends him on ^urpofethat I may 
appear ftubborn to him \ for fhe incites me to that in 
thfi letter. Caft thy humble flough, lays fhe ;~be op- 
|xAie widi a kinfman,— furly widi fcrvants, — let thy 
. toi^^ie tang with arp;uments of ftate, — put thyfclf into 
the trick of fingularity *> ~and confcquently fetsdown 

the 



174 TWELPTH'-NlGHT: Of, 

die iMiiiier how ; at a fad iace» a rei^erend carriage ii 
flow tongue, in the haUt of fome Sir of note, and fo 
forth. I have lim'd her, but it is Jave^s doing, and 
^^ make me diankful ! and when flie went awav 
now, let this fellow be looked to : Fellow I not Mal^ 
' voHo, nor after my degree, \m fellow. Why, every 
thing adheres together, that no dram of a firuple, no 
fcruple of a fcruple, noobftade, no incredulous or un 
iafe circumftance — what can be faid ? Nothing, t' ' 
can be, can come between me and the foil proij 
of my hopes. Well, Jwe^ not I, is the doer of 
and he is to be thanked. 

SCENE IX. 
Enter Sir Tobf , Fabian, and Maria. 
iir To. Which way is he, in the name of fknOatj I 





Sir i how is't with you, man ? 
• Adal. Go oflTi I difcard you; let me enjoy my pri« 
Tacy : gooff. 

Alar. Lo, how hollow the fiend fpeaks wkhin him ! 
did not I cell vou i Sir fohy, my lady prays you to 
have a care of nim. 

Mai. Ah, hai does Iheib? 

Sir To. Go to, go to ; peace, peace, wemoft deal 
gendv with him; ktcne alone. How do you, AAfcv- 
Uo? now is't with you ? what! man, dene the devil i 
confider, he's an enmiy to mankind. 

MaJ. Do you know what you fay? 

Mar. La, you ! if you fpeak ill of the devil, how 
he takes it at heart.^— -— Pray God, te be not be* 
witch'd. 

Fab. Carry his water to th*. wife woman. 

Mar. 



r 

I 



If^t jou mil 

Jktar. MiTiy, aiid it {hall be done to-morrow nom' 
iog if I live. My lady would fiot lofe him for moce 
Chan rU fay. 

M4I. How now, miftrds? 

Mar. O lord ! 

Sir to. Pr'ychee, hold tby peace ; that is not the 
way : do you not fee» you move him ? let me alone 
Win him. 

tFah, No way but g^ndenefs, gently, gently ; the 
nd is rough, and will not be roughly us!d. 
Sir To. Why, how now, my bawcock ? how doft 
thou, chuck ? 

Mai. Sir ? 

Sir To. Ay, biddy, come with me. What ! man, 
*tis not for gravity to play at cherry-pit with £itaiK 
Hang him, foul collier. 

Mar. Get him to fay his prayers, good Sir Toiy i 
^ him to pray. 

Mai. My prayers, minzt 

Mar. No, I warrant you, he will not hear of god« 
line6. 

Mai. Go hang yourfelves all : yoii are idle (hallow 
things ; I am not of your element, you fliall know 
more hereafter. [JExifs ' 

Sir To. Is'tpoffible? 

Fai. If this were plaid upon a flage nowt I could 
oxidemn it as an imj^obable fiftion. 

Sir To. His very genius hath taken the infedion of 
the device, man* 

Mar. Nay, purfue him now, left the device take 
air, and taint. 

Fai. Why, we fhall make him mad, indeed. 

A£ar. The houfe will be the quieter. 

Sir To. Come, weMl have him in a dark room and 
bound. My neice is already in the belief that he*s mad 1 
we may carry it thus for our pleafure and his penance, 
^ull our very paftime, tired out of breath, pn>mpc us 

to 



75 



J 7-6 TwELtTHTNic»;T: Or, 

• to hure merqr on bmt at which time we will faifig 
theidevice to' the bar^ and crowii tjiee for a finder M 
madmen ; but fee, but fee* * . 1^ 

SCENE X. • 

< I 

Efitsr Sir Andrew. # 

- F^h. Mere at^^tter for a M^ mpming. A 

Sir And. Here*8 the challenges t^ M : I Witit^A 
•feerje*? vjbegar and pepper in't, , / ,^^ 

Fab. Is't fo fawcy ? " 

Sir And. Ay, is't? I warrant him: dojbut ffs^jle 
-SirTo. Qhtm. pir Toby r/tids^ 

pVtb^ wbatfoeveribou artt f^ wt ht afcur^M 
taw. 

iW. Good ^nd valiants ' ./* 

^fV 7b. Wonder noty nor admire not in thymhd.'oilm 
J do call thee fo i for I 'tMlfiiw thee no reafOihi^h 
. ' iv*. A g^ n<)t« 5 That keep? you from thtifow 
of the law. 



• Sir To.fhoti eonfflto the Lady Qliyja, ««4 h M 

^Ujheafes thee kindly ; ^ut thou lieft mtitf if^^Jm 

ij mot the matter I challenge thee for. , . i,^.^ 

Fah. Very brief, and exceeding gopd icnfe-jeiSk \ 

Sir To. I will ^y-Uy tbee going j^e^ vbere ifiih 

thy £bance to kill mf^ffTT^ — . 
• Fat. Good; 



Sir To. Thou kilPfi mi like a rogue Off^^ vk 
Fab. Still y^Ki keep o'th* windy fide of the law \ 
gqpd. , . X 

Sir fa ^iffc, ^kHmH^ W (kdJ^Jfiet^ ttprn^ 
ofMrfmh^ hem^ijikffttf^ 
i[ m{fr^ aifdfo took to tbyfelf. Ti^ft^M Ocm ^i 

StrToAfthi^l^l^^gliqi^j^fSlfft^^^^^ 

riJ gjyp*t.*iim . ;;-:,,,. . , V ,v:-. • ,' /! 



Jf^hat you nviH^ '77 

Mar. You may have very fit occafion for*t : he is 
now in fome commerce with my lady, and will by^ 
wd-by depart. 

Sir To. Go, Sir Jndrew^ fcout me for him at the 
oimer of the orchard like a bum-bailifF^ fo foon aa 
ever thou (eeft him, draw ; and, as thou draw*ft, 
fwcar horribly ; for it comes to pafs oft, that a ter* 

tie oath, with a fwaggering accent (harply twang'd 
9 gives manhood more approbation than ever proof 
if would have earn'd him. Away, 
Sir And. Nay, Jet me alone for fwcaring. [£xi^. 
Sir To. Now will not I deliver his letter ; for the 
behaviour of the young gentleman gives him out to 
be of good capacity and breeding ; his employment 
between his lord and my neice confirms no lefs; 
therefore this letter, being fo excellently ignorant, will 
breed no terror in the youth ; he will find, that it 
comes from a clodpole. But, Sir, I will deliver hit 
challenge by word of mouth -, fet upon J^e- cheek a 
notable report of valour \ and drive the gendeman, 
(as, I know, his youth will aptly receive it,) into a 
mc^ hideous opinion of his rage, skill, fury, and 
impetuofity. This will fo fright them both, that 
ttey will kill one another by the look, like cocka* 
irioes. 

SCENE XL 

Enter Olivia and Viola* 

fab. Here becomes with your neice i give thenr 
way, 'dll be take leave, and prefently after him. 

&r Tp. i will meditate t|)e while upon ibme horrid 
mofigie for a challenge. \Extunh 

Oii. I*ve faid too much unco a heart of ftone, 
And Jaid mine honour too unchary out. 
Theresa ibmcthing in me; that reproves my feult ( 

Vol.. m. N Btf 



t^a TWELPTH-Nl€HT : Of, 

But fuch a head-ftrong potent fault it is^ 
That it bat mocks reproof. 

yio.W^ith the fame 'haviour that your paffion bcar% 
Goes oh my mailer's grief. 

on. Here, wear this jewel for me, *tis my pidurc h 
kefufc it not, it hath no tongue to vex you : 
And, I befccch you, come again to-morrow. 
What (hall you ask of mc that Til deny. 
That honour fav*d may upon asking give ? ^k 

Fh. Nothing but this, your true love for dp 
mafter. 

OIL How with mine honour may I give him that. 
Which I have given to you? 

Vlo. I wiii acquit you. 

Oli. Well, come again to-morrow : fare thee wtlL 
A fiend, like thee, might bear my foul to heU. ££m& 

SCENE Xlf. 

I 

Enter Sir Toby and Fabian. 

. Sir To, Gentleman, God favc thoc. < . 

Fio. And you. Sir. . .s 

Sirfo. That defence thou haft, betake theetcft) 
of what nature the wrongs are thou haft done him| I 
know not ; but thy interpreter, full of defpig^ 
bloody as the hunter, attends thee at tbs opchard^oid i 
difmount thy tuck, be yare in thy prqiaratiaa, . for 
chy affiiilant is quick, skilful, and deadly. ^ 

Fio. You miftake. Sir; I am furc^ no man iadi 
any quarrel to me ; my Temembronce it. very, ftot and 
clear from any image of ofience done to any mtt. 

&> ?V. You'll find it other wife, I aflure you ^ tharir 
fyrtii you hold your life at any price, betake youtP 
your guards for your c^ofite hath in him, »biC 
youth, ftrengtb, • skill, and wnitb can- iuniQi at» 
witfaft}^ » . . . .- ^ .. .: , .-■*,¥'- 



what ^du '9)014 -V 179 

yio. I pray you, Slr^ 'wtral is4ief _ ' 

Sir To. He is Knight, 6Mofd with unlvick'd nr 
pier^ and> an C9Cpet ^onfideration ^ but fat: is a dtivA 
m priratc brawl ; fouls and bodies hath be divorced 
three ; and hk incenfemenc at this moment is fo im- 
placable, that iatisfadion caii be none but by pangs of 
death and fcpukher : hob^ nob, is his words give'r, 
or take'r. 

A f^io. I wiQ return again into the houie, at)d defirp 
■ne condu& of the lady. I am no fighter* I hav^ 
Beard of ibme kind of men, that put quarrels pur'* 
pofely on others to tafte their valour : belike, tbta is 
a man of that quirk. 

Sir 9>. Sir, no : his indignation derives itfdf out of 
a very-^CDmpeteni: injury^ therefore get you on, and 
g^t kim hB defire. Back you (h^ll not to the i^Ctt 
unlcis yoQ uodertake that with me, vrhich with as 
much fafety you might anfvver him ; therefpre on, or 
Arip your'fword ftark naked ; ibr meddle you mpft, 
that's cenain, or forfwear to wear iron about you. 

J^. This is as uiKivil, as ftrangc. I bcfcech you, 
4o mm this coureeous <yffice, as to koawof the Knight 
wliat my offence to him is : it is fomething of my 
ltf||l^{KiGe;*4ioihing of mv purpofe. 
! .UtTk I will do lb. Signior Faiian, (by yoq by 
A gcsRleman *till my return. lExit Sir Toby. 

' iSa.'Bacf ym, Sir, do yog know x>f this matter? 
'^iv^«. i kxxcrwj the Knight is incens'd ^gainft yotu 
even to 9 mortal arbttrement 1 bat nothing of the cir» 
tenftMoe more, 
I iHo. \ boieech you, what manner of man ii heP 

Fah. vNothing of diat wonderful promift to read 
^rin t»y his form, a3 you arc like to find in ^he proof 
^i Ms vateor. He is, indeed. Sir, the nxifl skiifuU 
1bli»dy, and fatal oppoHte that you could poffibljr 
-here nund in^^y prt of Ulyrsa: will you walk to- 
wards him ? I will make your peace with him^ if i can. 

v* N 2 yuf. 



i 



So TWELrTH-NlGlTT: Or, 

Vio. I (hall be much bound to you for't : I am 
one, that had rather go with Sir Prieft than Sir Knight: 
I care not who knows fo much of my mettle. 

[^Exeunt. 

SCENE xm. 

Enter Sir Toby, and Sir Andrew. 

SirTc. Why, man, hc*s a very devil; Ihave not 
feen fuch a virago; I had a pafs with him, ripi^| 
fcabbard and all ; and he gives me the ftuck in wicn 
fuch a mortal motion^ that . it is ineviuble ; and on 
the anfwer, he pays you as furely as your feet hit the 
ground they llqp on. They fay, lie has been fencer 
totheSwh^y, _ _ 

Sirjnf* Pox on*t. Til not meddle with 4|im..v 

Sirfo.^ AV| but he will ^ nDW:t:|C p^JA^d ^ . ::- 
P^M^mn Icarce hold luiq yonden. , , , ^,y, I 
^ SirJnd. Plague oa't, ^n I though(ohe ^..^(dcii 
yalianu ^4 f^ P^^^^g ^n fencC) I'd ha^i^^i ieoQt^^ioi 
damn'5l,cre rd have cbaljcng^d hiji>« I^ hjm Ift^fbe 
mftcr Ay^ and PU ^Vf? him flffi hork^^fftj i:^4Ia. 

Sirjlp. I'll make the motion; ftand here, make a 
good mew on*t 5 — Thi^ ihall end without the per- 
dition of fouls ; marry^ Til ride your horfe^ ^Ctll as 
I ride you. '; C4^* 

Enter Fabian and Violav . . . ' . /, 

1 have his; horfe to take up the quarrel^ J have^- 
ibaded him^ the youth's' a devil. [7i^ Fkbian. 

i^ak He is as horribly conceited of him ^ and pants 
•and looks pale, as if a bear were at hti heels. 

Sir 71?. Thcfc's no remedy. Sir, he will fight with 
you for's oath fake: marry, he had better bethoug^ 
him of his quarrel, and he finds That now icarce to 
be worth talking of-, therefore draw for the fup- 
portante of his vow, he protefts he will not hurt you. 



what you 'mil i'8x 

Fio. Pray God defend me! a little thing would' 
make me tell them how much I lack of a man. 

Fab. Give ground, if you fee him furious. 

Sir To. Come, Sir Andrew^ there's no remedy j the 
gentleman will for his honour's fake have one bouc 
with you ; he cannot by the duello avoid it \ but he . 
has promisM me, as he is a gentleman and a foldier, 
^ will not hurt you. Come on, to'r. \jLhey draw. * 
^ Sir And. Pray God, he keep ^is oath! 

SCENE XIV. - 

Enter Anthonip. . - 

Vio. I do afiure you, 'tis againft my wifK 

Axi. Put' up your fword ^ if this youftg gentleman 

Have d6iri^ffdKe, I uke the fault on mt ; 

If you offend him, I for him defie you. '^ramn^. 

' kw-^. You, Sir? Why, what arey^u? 

^^'-if/a^^C^ie^ Str, that for his love dares yet donaore 

TUli 2^ hik^e heard him brag to vou he wHl. 

^"*2irnC-Nay9 if yoabe an tmdertaker, I am for yoa. 



?.i. 






* . 



\PrawsJl 
Enter Officers. 

. good Sir Tohyy hold ; here come the oBicers. 
Sir To. V\\ be with you anon. 
Vio. Pray, Sir, put your fword up if you plcaft. 

. » •. \To Sir Andrew. • 

Sir And. Marry, will I, Sir-, and for that I pro-* 
misM you, I'll be as good as my word. He Wi)! bear 
you eafily, and reins well. 

>i Off. TWs is the man ; do thy office. 
\ X Off. AnfJboniOt I arreft thee at the fuit of Duke. 
OrfinQ. 
. Ant. You do miftake me. Sir. 
,' ^ Off. ]!jlp, Sir, no jot: 1 know your favour well ; 
Tho* now you have no fea-^cap oh your head. : 

N 3 Take 



^ I 



i8^ Tw EL FTH-N I GtiT: Or, 

Take him away t he knows^ I know him wcH. 

' Ant. 1 muft obey. This comes with feeking jou j 
But thcre^s no remedy. I ihall anfwer ic. 
What will you do? now my ncccflity 
Makes me to ask you for my purfe. It grieves me 
Much more, for what I cannot do for you, 
Than what befals myfcif : you (land amaz*d. 
But be of comfort. 

a Off^ Come, Sir, away. 

Ant^ I muft intreat Of you ibme of that mony. 

Via. What Mony, Sir ? 
For the fair kindncfe you have fhew'd me here. 
And part being prompted by your prcfent trouble. 
Out of my lean and low ability 
1*11 lend you foMething j my Haf'ing is ndt much v 
Wl iiwke diviflort of my prcfent with ydti : ' ■ 
Hold, thcre'^ hdf my toKtx. 

Ant. Win ydu deny me hofT?- • 
Is*t poflible, thae my deferts to you 
Cm lack pofuafldA > do fiot tempt wi^ Tnf&f^,' 
Left that it make m^ fo Unfeund a hi$n;^* - • •'- '" 
As to upbraid you with thHfe kindncifics' ' •^- 
Thfitt I have done for you. 

'- Fh. I know of ndne, ' -^ 

Nor know I you by voice, or any feature : '^ ' ** ^ 
I' hate ingratitude more in a, man. 
Than lyin^;, vainnefs, babling drunkennef^ , - , . ' 
Or any taint of vice, whofc ftrong dorrupiion 
Inhabits our frail blood. ' 

Ant. Oh, hea v'ns themfclves!—— 

2 Off. Come, Sir, I pray you, go. 

Ant. Let me fpeak a little. This youth that you 
lee here, 
I fnatch*d one half out of the jaws of death \ 
Relieved him with fuch fanfiity of love. 
And to his image, which« methought, did promile 
JMoft venerable worth, did I devotion. 

I Of. 






'; ; 



n^iat you HidR. > ' : 183 

I Off. What's that to us ? the time goe^ hf^^ away. 

jinl» But ob^ how vile an idol provesi thi$ Qod ! 
Thou haft, Sihaftian^ done good feature fliapac* 
In nature there's no blcmiih but the mindc 
None can- be call'd deforhi'd> but the unkiRd« ; : 
Virtue is beauty; but the beauteous evil 
Are empty minksj o*erfiouri(h*d by the devJI. • r ; 

I Off. The man grows mad, away with Jiim: 
Come, come, Sir. 
«* Anl. I^e^ me on. {E^iit Anthonio ««/^ Off.cirs. 

Vw. Methinks, his words do from ilicb po^on fly, 
That hg^ bel^pyes bimfclf j fo do not I : - - 

Prove true, imagination, oh, prove true, x - - t 
That I, dear brother, birnow ta'cn for. you fp ; - ;^ 

SirTo^ QH"^ hither, Kniglit ; come bithcr,r/^3^;i r 
well whirper o'er a couplet or two of Rnift. iageiaws? 

Vio. He namM Sebaftian ; I my brother, l^jpw. - v; 
Yet Jiving in my gla6 ; even fuch, and fo ^ 
Li fevour was my brother^ ^ h< went , ' 

Still in tiliisiaibjony colour, bnuuneoti - . 
For him I Iniicaie : oh, if it pirove, - J" 

Tempers are kind, and iait wava iidh inlpvo, 1 

r . [Eicitr 

Sir To. A very diihoneft paltry boy, ^nd more a 
coward than.a bane % hi& difhoncfty appoarf in J«^y iog-^ 
his friend here in neo^y, and denying, -him ^ >and: 
for his cowar^ihips a&k Fakiau, . - \ * T 

Fab. A coward, a moft devout coward,: jEel^g^^uf. 

U) It. 't ^.■. :- " 

Sirjfnd. 'Slid, 1'U afra" him again, a^d beat kim. 
Sir Ta. Do, cuff him foundly, but n^ver dra^ thy 

fword, . .L '^. :\ 

Sir jfnJ. An I do not, • [£xi/ Sir Andrew. 

Fab. Come, let's fee the event, , ^ - - - ^ •• 

Sir To. I dare Jay any mony, 'twill be nothing yet. jr 



^ A »• 



N 4 ACT 



■ S4» 



t. 



TwELrirHt3^p«i*lr : Or, 


1 


c X IV. 8c eWe I. 


..-3 


' ^ *!r&f Street." 




. . « • - ■ . : * . . . •. 

' Sftter Sebaftiani and Clown. * 

. > I* 


-ol 



Clowk. v/ 

1- • . ■ * •' 

WILL you make mc believe, thdtViMniSF 
fefic foryou? , ' v -. T T: 

^^^. Go to, go CO, chou art a fooli|(bfe)to#^. 'L^ 
me be^ckar of thee. 

Q^. W^U;hcld our, P^aithc no, I'do^^notTcftbw 
yc^^t^ I am not fefit* to you. by my l^a^^ t6 Vid 
youxQn[)C. fpeak with b^r^ nor ypnr.nahi^ is >W mS^ 
tter OfaiQf^ nor ihi* h fM^mf ubh Jielth«r ^f ' YKMhiH|g 
that is fo, is ft). ^ '^ ^ :n ' » Ji^ 

5^*. I pr'ytbee, vent thy foHy ^tHlM)^ "^i 
thou know'd pot roe. r' - '<~^ * '* 

C&. Vent n^y folly ! — . he has heawl thai ^#&ftJ?«l 
fome great man, and now applies it'tO'ti;'fool. ' VtirS 
my folly! I am afraid, this great lubber the wdrld 
Will prove a cockney : I pr'ythee nowj ^mgird thv 
ftrangf^ncfs and tell me- what I ifaEll WKt itbj^ £ildy | 
ihalJ I vent to tcr» that thou art coming'^' ^^ "^ ^' ' 

Seb. ' I pr'ythee, foofifli Grtdi^ dJbpaK'fitfMftiSI 
tbert'^ mQoy for thee. If you tarry longer, 1 ihaU 
give worfe payment. 

Clo.,3y,.my uoth, thou haft an open^ltand; \hei^ 

■ •J * ■ 

- i • • " 

r I fir*)ii€i, fl»ll/h Greek,! Greek, was as muqh as to &y Bawd 
tt Pander. He onderftood uie Clown to be a^idg in thgt office; 
A bawdy- houfe was caHcd Cdrln'tb; ind the frequenters of it C#- 
rintbiam^ which words occur frequently in Sbakefiear, efpecially 
in Timon of Athens^ and ^iwry I vih. See the reafon in a note on 
the former of thofe plays: Vet the Oxfird Editor alters it to 
teek. 

ivift 



*w> 



t«^ir>A« >iiifi/R ' ^ ^ » t^S 



wife ineO) that give fools mem;, f get thcmfeljes a 
good reporf aUd* fiiutdbn'^rears' pdrchaie. ^ * 

Enter Sir Andrew, Sir Toby, and Fabian. 

Sir Jnd. NoW) Sir, have I met you again ? there*a 
for you. {Strikir^ Sebaftian. 

Seb. Why, there's for thee, and there, and there \ 
arc all the people mad? ^Beating Sir Andrew. 

Sir To. Hold, Sir, or fll throw your dagger o'er 
^hwtTe^t . :, ' 

Qo. This will I tell my Lady fbaight : F wtould not 
^ in fiKnc t)C>your coau for two pence. 

\E9cii Clown. 

..^^.j.iCotne on. Sir % hold. [Holding Sebaftian. 

I Sk.yMt ITay, let him alone, Til go andchd* wa^ 

tQriForjE , :wifh him; I'll havi^ sm adioa dF'biitterv 

him> :if thcirc be a«f law in Ulyridi thoTl 

him firft, yet it's no matter for thkt. ^ 

. HSflJ.-rli4t,f^ <hy hand. ' ' ; * . 

Sir to. Come Sir, I will not let you go, ^ €^mej 
187 young foldier, put up your iron ; you are well 
9«iQ^d :; come on. / ^^ 

t.. fS«^. I Will be free from thee. What wouklfl: thou 

iC^^hciu^^ft tempt me further, draw thy fwoH.'' :; 
Sir To. What, what? nay, then, I hiult have an 
pmce i^'lwo/bf this malapert blood from you. 
. '. . .-1 C^{7 dra^. dndjl^hf. 

iT&ift fetsns to carry a piece of iacire upon AUn^ui, the crying 
nkvance of that time. The Grants geoeralty wpi^ ibf fearteen 
yeatv; and the petitions being referied to a committfee, it was faf* 
pc^SBed that money gained fitvonrable cepons from ciicnce. 




SCENE 



I 86 TwELi'TH-^NlVHt: Or, 

S C E N E • II. 

Enter Glhria. 

OIL Hol^, 7i)i/ •, on thy life, I charge thcc, hold- 
\ Sir To. Madam ? . 

OIL Will it be ever thus ? ungracious wretch. 
Fit for the mountains' and the barbarous caves, 
Whcretnanners ne*cr were prdich*d : out of my fight! 
Be not offended* dear Cefario: » ^* ■» 
Rudesby, begone! I pr*ythce, gentle friend, 

[^Exeunt Sir Toby, and Sir Andrew. 
Let thy fair wiibom, not thy pafllon> fway 
In this uncivil and unjuft extent 
Againil thy peace. Go with me to my houfe. 
And bear thou there, how many fruitlcis pranks 
^ This rufHan hath botch'd up, that thou thereby 
May *ft fmile at this : thou (halt not chufe but go i 
Do not deny -, befhrew his fwl for me. 
He darted one poor heart of mine in thee. 

S^b. What relifH is in this ? how runs the ffream ? 
Or I am mad, or elfe this is a dream. 
Let fancy ftill my fenfe in Letbe ftecp. 
If it be thus to dream, ftill let me flcep. 

OR. Nay, come, I pray : 'would, diou'dft be nVd 
by me. 

Sei. Madam, I will. 

OH. O, fay fo, and fo be ! \Exeunt. 

3 3^1/ tufimm Uih boteh*d up, — ] i. 4. fivvlM ttid bdkjiMi.' 
A botch bnj3g a fwelling or abicefs. * > 



SCENE 



what you *wilt 1S7 

• • • 

T 

SCENE III. 
jin Apartment in QI&h\s!s Houfe. 

Enter Maria, and Clown. 

JI&r.T^AY, I pr*ytbcc, put ofl this gowfl, and 
JlN this bearcl; makq him . believe, thou, art' 
^Tepa$ the toratc} do it quickly. TJl call Sir ^ohy 
thcwhilft. , - [^/ir// Maria- . 

Clo. Well, ril put It on,. and I wiJldiflcmble my- 
fdf ia't; and I would, I were the firft that ever dif- 
fembled in fuch a gown. I am not tall enough to 
become the fundion well, nor lean enough to be 
thought a good iludent ; but to be faid an honeft 
man, and % good houfekeeper, goes as fairly,^ ^ as to^ 
%, ^.^nxj&A man and a great fcholar. The com- 
petitoc^^: eoten 

Enfer Sir Toby, and Maria. 

•. Str-^Sb. Jifve blefi thee, Mr. t^arfon. 

do. Btms dies^ Sir Tobyi •* for as the old hermit 
*• of Prague^ that neTer few pen and ink, * very wit- 
^' tily laid to a neice of King Gorboducky that that, is, 
^iia: fyl bdog Mr. Parfon, am Mr. Paribn; for. 
^^ what is that, but that ? and is, but is ? 
Sir ^0. To him. Sir fopas. 
• ♦ • • • 

4 ms'fofltft a CARBFUL man and a great fcJbolar.'} TUs rtfers 
to what went before^ / am not taU intngb U het»me ibe/nnShn 
nmOp ^ior ham nmngh tahe ttot^bi a good ftudeni i it u plain then 
dttt ihakefiear wrote, as to fay a c^raCbful man^ i. g. comely. 
To ddt tlK OxJ^d Editor &ys, reag. 

5 ^ftrfntniiify /aid ''''^ thai that ii, it:1 This is a ^ery bu- 
nooroos banter of the rales eftablifhed in the fchools, that all rea* 
jonings are ex pr^eognitis isf pr^eoncejis, which lay the foundation 
of tvary fdenc^ in thefe maxims, nviat/oever is, is ; and it is im- 
UfShUJor the fame thing to he and not to be ; with much tMJXi% of 
tfi like iSnd. 

Clo. 



i88 Twelfth-Night: Or, 

Clo. What, hoa, I fay, — peace in this pnTon F 

Sirfo. The knave counterfeits well ; a good knavc^ 

[Mai vol io mtbin. 

Mat. Who calls there? 

Clo. Sir 7'opas the curate, who comes to vi(k MaU 
volio the lunatick. 

Mai Sir Topas^ Sir Topas^ good Sir Topas^ go to 
my lady. 

Qo. Out, hyperbolical fiend, how vexed thou this 
man ? 
Talked thou of nothing but ladies ? 

Sir to. Well faid, matter Parfon. 

MaL Sir Topas^ never was man thus wrongM \ good 
SxtTopas^ do not think I am mad; they have laid 
me here in hideous darknefs. 

Clo. Fie, thou diflioncft fathan \ I call thee by the 
mod modeft terms; for I am one of thofe gentle 
ones, that will ufe the devil himlelf with curtefie r 
fey'ft thou, that houfe is dark ? 

Mai. As hell,' Sir Topas. 

Ch. Why, it hath bay-windows tranfparent as bSi- 
ricadoes, and the clear ftones towards the fouth-north 
are as luftrous as ebony ; and yet complained thou 
of obttruftion ? 

Mai. I am not mad. Sir Topas ; I fay to you, this 
houle IS dark. 

C/^.JM[adman, thou erred; I fay, there is no dark- 
nefs but ignorance ; in which thou art riiore puzzled 
than the Egyptians in then* fog. 

Mai. I fay, this houfe is as dark as rgn6rknce, 
though ignorance were as dark as hell ; and I (ay, 
there was never man thus abus'd ; I am do more mad 
than you are» make the - tryal of it in any conftanr 
quedion. 

Ck. What is the ofJfcion of Pythagoras^ concern- 
ing wild-fowl? 

Mai. 



J^hat you nvilL i Bg, 

Mai. That the foal of our grandam might happily 
inhabit a bird. 

Ch. What think'ft thou of his opinion ? 

Mai. I think nobly of the foul, and no way ap* 
prove of his opinion. 

Clo. Fare thee well : remain thou ilill in darkne(s \ 
thou (halt hold th' opinion of Pythagoras^ ere I will 
allow of thy wits i and fear to kill a woodcock^ 
left thou difppOefs the foul of thy grandam. Pare thee 
well/ 

Mai. Sirfopas, SrrTopas! — 

Sir To. My moft exquifite Sir fopas I 

Clo. ^ Nay^ I am for all waters. 

^^z*. Thou might'ft have done this without thy 
beard and gown i he fcc% thee not. 
^ Skr To. To him in thine own voke, and bring me 
wptd how thou fihd'ft him: I would, we were all 
ri^ of this knavery. If he may be conveniently de- 
livePd, I would, he were ; for I am now fo far in 
ofience with my neice, that I cannot purfue with any 
£^ky jhis fport to the upihot. Come by and by to 
^^Jdml^^ lExit ^wiib M^isu 

S C E N E IV. 

ft *« • . - 

Clo. Bey Robin, jolly Robin, Ull me how wy laif 
.->.' -^be$. [Singing. 

. JOai^ FooJ^ 

Clo. My lady is unkindj perdic. 

Mai. Fool* 

. Cla. Jlas^ fvty isjbefof 
Mai. Fool, rfay; — 
CIq» She bves another — - who calls^ ha f 

jS 2V«f9 lam fir all waiin.l A pbrafe t^Jcen fiioti the adores 
^-^- of makiog the audicnoe cry either with oiii|)i or grief. 

Mat. 



109 TwEL^T-H-Ni«Rvt: Or, 

Mall Good fool, as crer ibaa w'lkMxtc nsdl.ac 
my hand) help tne to a candle^ and pen, ink) and 
mper ; as I am a geodemao, I will ibe to be (bwlc- 
fbl catheefor't. 

Clo. Mr. Maholio! 

MaL Ay, good fool. 

C^. Alas, Sir, how fell 7011 befidea yow Snm 
wlu? 

iV/tf/. Fool, there was never man (6 not»rtouA/ 
abiis'd ; I am as well in my wics, fool, as chou art. 

Clo. Bot as well ! then thou art mad, tockcxi) tf you 
be no better in your wits than a CboL 

MaL They have here propertjcd me ^ kee^ mc in 
darkoefSf ftnd minifters to me, al&s, ani do all they 
can to face me out of my wits. 

CI0. Advife you what you lay : the miinifter is here. 
Maholifij Mahidio^ thy wits the hear'ns re&ore : en* 
deavoor thyfttf to lloqp, and. leave tby. Tain feabhtft 
babble. 

Mai. Sir Topau -—^ 

Clo. MatntatQ no words with him, 9aQdiiaU(>v, . /^ 
Who,. I, Siri not I, Sir. God b'w'you^ gotd St 
Topas " . :. 

Marry, amen » I will, Sir, I wilL 

Mai. Fool, fool, fool, I lay. 

Oo.^ Alas, Sir, be patient. What ky jf p^, % |L | 

am fhent for fpcaking to you. 

' Mai. Good fool, help me to Tome lights ^and Joose 

paper; I tell thee, I am aa weU in my-wita, ai 40| 

man in Illyria. /. y 

Clo. Wcll-a*day, that you were* Sir! ^,v 

Md. By this hand, I am: good fooL ^'pc.l^ 

Cper and light ; and convey what I fet dowii to my 
idy: It Ihall advantage thee more than ever the 
bearing of letter did; ^^ - 

Clo. I will help you to't. But telt.m^ true,* ale 
you not mad, indeed, of do you but counterfeit 2. . « 

Mai. 



Mai. Believe <M, I am not 2 J aeli dint true. 

Clo. Nay, Vl\ ne'er briievf a 9md*inai^ 'dU I fee 
his brains. I will Satch you Hghu atid paper, and ink; 

AtaL Fool, i'U miuice ac kiibe higlieft degree i ' • 
I pr'ydbee, be g^ne. 

Cb« lam pme^ Sir^ and anan^ Sir^ C^^g^ng. 

rU be with you again 
In a trie f 9 like to ibe oU vieff 

Tour need to Juftain : 
If^ with dagger of Utk^ in Us rage^ and bis wratb^ 

Cries^ ab^bal to the JeVil: 
Uhe a mad lad^ pare tby nails^ dad^ 

Adieu^ good man drivel. ^ IRxil, 

S C E N E V. 
Gbanges to another j/lpartment in Oiivia'i Sotife^ 

Enter Sebaftiao. ,. 

^e^.^^HIS is the air, tfattis the glorious lisif 

X < Ttiis pearl ibegave mc, I do ieet^c and fix't^ 
And tkoiij^ ^tis wonder that anwmps me thus. 
Yet 'tis not madne& Wher A ifjn^iiwMi dni f 
I coaid Mt find him at tbe Shpbemti 
Yet there lie was, and theni ' I found this aaAit, 
That he did nuige the toilm to ftek laeioat. 
ffis ooonlel now might do me golden fervice ;*-— 
For tho' my foul difputcs well with my fenie. 
That this may be fome error, but no madnefs ^ 
Yet doth this accident and flood of fortune 
So far ezosod * all ioftance, all diftourfe \ 

\ J .^^^ Ifimut this cre^k.] OmHi» for account, inforxnation. 
Tlie Oxfbrd Editor roundly ahtn it to atrrnt ; as he does alinoft 
every wood that SJbakJ^ior ofes in an anomalous iignification* 

8 •— — 4/f xnibi]ice» nZ/difcouric}] Inftmui^tor^i&i difiwrfi^ 
for fvalbii, 

Thtt 



192 TwEtPTH-Nickt: Or, 

That I am ftadjr (o dtftrofl mine eyes* 

And wrangle with my realbn that perfiiadei me 

To any other truft, but that Vm mad ; 

Or dfe the Lady's mad 1 yet if 'twere j(b. 

She could not fway her houfe, command her fdlawctSf 

Take, and give back afiairs, and their difpatcb. 

With foch a fmooth, difcreet, and ftable bearmg. 

As, I perceive, (he does : there's fomething in't. 

That is deoeivable. But here fhe comes. 

Enter Olivia and Prie^. 

OH. Blame not this hafie of mine: if you mean 
well. 
Now go with me, and with this holy man^ 
Into the chantry by % there before him. 
And underneath tl^t confecrated roof. 
Plight me the full alTurance of your fiiith s 
That my moft jealous and too doubtful Ibul 
May live at peace. He {hall conceal it^ 
Whiles you are willing it (hall come to note } 
What time we will our celebratbn keep 
According to my birdi. What do you iky f 

Seb. I*il follow this good man, and go wkh yoo} 
And having fwom truu, ever will be true. 

OB. Then lead the way, good fitther} and hctT'ns 
& ihine. 
That diey may £iu-ly note thia aA of oiiiief 

[Eximt, 




ACT 



tf^^ji^wiH)^ ' . / ' 193 



A.CT: -V, . S C EN E-rl. -* 



• r 



rbc S T Jt E E r, 

Enf^r Clown, Md Fabian^ 

Fabian. 

NO W, a$ tfaoo tov*ft me, lit mc fee bis letter 
Clo. Good Mr. Fabian^ grant tne another 
rcqueft. 
fiib. ^ Any thin|^. 

Cio. Do not defire to fee this letter. 
Fab. Tlya is to give a dog» and in t c com pw ce dg^ 
fire my dog again. 

•■ ' . * ' 

Enter J)uke^ Viola, Curio, and lords, 

J)uh. Blelpng you to the lady Oliviai fiiendf f 

Qo. Ay, Siry we arc fomc of her trapping. ' 

Duke. J jkin^w thee well % how doft thou, my good 
fellow? 

do. Tfi^jT^ '^Sir, die better fefr my foes, and' the 
wcrgb^rdPlf j^ieods. 

buke. Juft tbe contrary r the better for tfef friends, 
•^y^sJfftt .5ir, the worfe. 

Duke. How can that be ? 

Clo. May^inSIr, they praife me, and imk^ tilt>1iifs 
of cyc^-^B^, my foes tell me plainly, I am an ais : 
fo that by my foes. Sir, I profit in the knowledge of 
myfelf ^ and by my friends I am abufed ; ' fo that, 

-^ ^ con* 

I /• thai eonelufioni to If a$ )i|Wi«tf^l Tno' it might be unrea- 
jonaole to call oar Pok^s'loQli ^nd^kopr^a ^very where to aocoont 1 

Set, if we didy for the generiflitf. ^Ak>uld find them refjponfible. 
at what monftrous abfurdity have ^e here ? the Clown is affefi* 
ingtoargqeferioafly aod in form. I imagine^ the Poet wxofni 

S4 thu, €9nclu/m to ^^ asked, it 



194 TwEL^TH^Nlcttrrt Oty 

conclufion to be asked, is, if your four negatives make 
your two aitirmatives^ ^hy, thtn the.worie (^ my 
friends, and the better for my foes. 

Duki. Why, this is ttcellcnt. 

Clo. By my troth, Sir, no ; tho* it pleafe you to 
be one of my friends. 

Duke. Thou (halt not be the worfe for me, there's 
gold. 

Clo. But that it would be double-dealing. Sir, I 
would, you could make it another. 

Duke. O, you give me ill counfel. 

Clo. Put your grace in your pocket, Sir^ for this 
once, and let your flefli and blood obey it. 

Duke. Well, I will be lb much afinner tobea dou- 
ble-dealer : there's another. 

Clo. PrimOj fecundo^ tertioy is a good Play, and the 
old faying is, the third pays for all : the triplex. Sir, 
is a good tripping meafure ; or the bells of St. Berniet^ 
Sir, may put you in mind, one, two, three. 

Duke. You can fool no more money out of me at this 
throw ; if you will let your Lady know, I am Ikk 
to fpeak with her, and bring her ak>ng with you, it 
may awake my bounty further. 

Clo. Marry, Sir, lullaby to your bounty •till l^iomc 
again. I go, Sir, l)ut I would not have you to think, 
that my dcfire of having is the fin of covetoulhels ; 
but, as you fay. Sir, let your bounty ukea nap, and I 
will awake it anon. [Exit Clown. 

SCENE n. 

Enter Antonio, and Officers. 
Via. Here comes the man. Sir, that did reiboe me. 



/. #. fo that Ute condufion I hxtt to demand of 76a b'Urit, ityl^u 
four, &r. He had in the preceding wonb been inferruig mme 
fnmifisj and now comes to the e^BcTyJwn very la^icallj \ yeu grant 
me^ (ays hCj the premifes ; I DOwaJcyoutogr»At dieconclufton. 

J}uk€^ 



what you ntfkh 195 

Duke. Thai &ce of his I dp remember wjdUi 
Ya wbcn I &w k laft» ic wsis befmcar^fl 
As black a& Vulcan^ in the fino^ik of war : 
A faawbliog yeflel wats he captain of. 
For fliallow dratigiit and bulk unpri^able^ 
With which fuch fcathful grapple did he make 
Wkh the moft noble boccoxn of our fleet. 
That very envy and the tongue of I0& 
Ciy'd fame and honour on him. What's tfae matter ? 

I Offi. Orjmo^ this is that ^»/^/!W, 
That took the Pb0tim and her fraught {roakCam^ i 
And this is he, that did the Tyger Board, 
When your young nephew Tiius loft his Jeg : 
Here in the ftreets, defperate of flume and ftate. 
In private brabbk did we apprehend him. 

Vio. He did me kindnefs, Sir ; drew on my fide $ 
4Bot in conclufion put ftrange fpeech upon me, 
I know not what 'twas, but diftra&ion. 

DiAe. Notable pirate ! thou fait^water thief ! 
What feolKh boldnefs brought thee to their mercies^ 
"Whom thou in terms fo bloody, and io dear, 
Va& aiade thine enemies } 

Ant. Orfino^ noble Sir, 
Be pleaied that I fhake ofT.thefe names you give me : 
jtmamo never yet was thief, or pirate \ 
Though I confefs, on bate and ground enough, 
-Orfino^t enemy. A witchcraft drew me hither : 
That moft ungrateful boy there, by your fidc^ 
From the rude fea*s enraged and foamy mouth 
Did I redeem \ k wreck paft hope he was : 
His life I gave him, and did thereto add 
My love without retention or reftraint \ 
All his in dedication. For bk fake, 
Did I expoie myfelf (pure, for his love) 
Into the danger of this adverfe town \ 
Drew to defend him, when he was befet \ 
Where being apprehended, his falfe cunning 

O 2 (Not 



196 Twelpth-Night: Or, 

(Not meaning to partake with me in danger) 

Taught him to face me out of his acquaintance ; 

And grew a twenty years removed thing. 

While one would wink : dcny'd me mine own purie^ 

Which I had recommended to his ufe 

Not half an hour before. 

Fio. How can this be ? 

Duke. When came he to this town ? 

jfni. To day, my lord *, and for three months before, 
(No Interim^ not a minute's vacancy,) 
Both day and night did we keep company. 

SCENE ni. 

£x^r Olivia, and Attendants* 

Duke. Here comes the countefs ; now heav'n walks 
on earth. 
But for thee, fellow^ fellow, thy words are madnefi : 
Three months this youth hath tended upon mej 
But mpre of that anon — Take him afide.— - 

OIL What would my lord, but that he may not have, 
Wherein Olivia may fccm ferviceable ? 
C^fario^ you do not keep promife with me» 

Fio. Madam ! 

Duke. Gracious Olivia^— -^^ 

OH. What do you fay, Cefario ? Good my lord-^ 

Vio. My lord would fpeak, my duty huflies me. 

OH. If it be aught to the old tune, my lord. 
It is as ^ flat and Fulfome to mine ear. 
As howling after mufick. 

Duke. Still fo cruel ? 

OH. Still fo conftant, lord. 

Duke, What, to perverfenefs ? you uncivil lady, 
To whole ingrate and unaufpicious altars 

a — — «/ PAT atui/u//ome] Wc fhould read, as flat. 

My 



Jf^at you njoilL 197 

My foul the faith fuU'ft offerings has breath'd out. 
That e'er devotion tendered. What fliall I do? 

Olu Ev'n what it pleafe my lord, that fhall become 
him. 

Duke. Why (hould I not, had I the heart to do't, 
» Like to th' Egyptian thief, at point 6f death 
Kill what I love ? (a lavage jealoufie. 
That fometimes favours nobly ;) but hear me this : 
Since you to non-regardance caft my faith, 
And that I partly know the inftrument. 
That fcrews me from my true place in your favour : 
Live you the marble-breaded tyrant ftiil. 
But this your minion, whom, I know, you love. 
And whom, by hcav*n, I fwear, I tender dearly. 
Him will I tear out of that cruel eye. 
Where be fits crowned in his mailer's fpight. 
Come, boy, with me \ my thoughts are ripe in mif^ 

chief: 
ril lacrifice the Iamb that I do love. 
To fpight a raven's heart within a dove. [Duke goitig^ 

Vk. And I moft jocund, apt, and willingly. 
To do you reft, a thoufand deaths would die. Ifallowutg* 

on. Where goes Cefario ? 

Vio. After him I love. 
More than I love thefe eyes, more than my life ; 
More, by all mores, than e'er I ihall love wife. 
If I do feign, you witneiTes above 
Punifli my life, for taintii^ of my love ! 

0£. Av me, detefted ! bow am I beguil'd ? 

/^J0, Who does beguile you ? who does do you wrong ? 

OH. Haft thou forgpt thy felf ? Is it fo long ? 
Call forth the holy father. 

Duke. Come, away, [T^ Viola, 

OIL Whither, my lord ? Cefario^ husband, ftay. 

3 Lih to tF Egyptian tb'tef,^'] This EgypiioM thief was %«- 
mis. See Heliodaruis jEtbiopics. Mr. Thnhald. 

O 3 Duke^ 



tgH TwELPTH-NiGHT: Or, 

DuJce. Husband ? 

OIL Ay, husband, Can he that deny ? 

Duke. Her husband, firrah ? 

yio. No, my lord, not 1. 

OU. Alas, it is the bafenefs of thy fear. 
That makes thee ftrangle thy propriety ; 
Fear not, Cefarioy take thy fortunes up : 
Be that, thou know'ft, thou art, and then thou art 
As great) a3 that thou fear'fL 

Enter Prieji. 

welcome, father. 

Father, I charge thee by thy reverence 
Here to unfold, (tho* lately we intended 
To keep in darknefs, what occafion now 
Reveals before *tis ripe) what, thou doft know. 
Hath newly paft between this youth and me* 
Prieft. A contrad of eternal bond of love, . 
Confirmed by mutual joinder of your baixlsy 
Atteftcd by the holy dofe of lips, 
Sicrengthened by enterchangement of your rings ( 
And all the ceremony of this compa& 
SeaPd in my funftion, by my teilimony : 
Since when, my watch hath told rhe, towVd my grave 

1 have ttaveird but two hoars. 

Dukf. O thou diflembling cub! what wiktbovb^ 
When time hath fow'd a grizzel on thy cafe f 
Or will not elfe thy craft foqukrkly grow. 
That thine own trip fhall be thine overthrow ? 
Farewell and take her i but dircft thy feet, 
Where thou and I henceforth may never meet« 

Fio. My lord, I do protcft— *— — 

on. O, do not fwear ; 
Hold littli^ faith, tho^ thou baii: too much fear ! 



SCENE 



Hi)at you nvilL 1 99 

E N E IV. 

Enter Sir Andrew, wilb bis bead broke^ 

Sir And. For the Jove of God a furgeon, and fend 
one prcfently to Sir Toby. 

Oil. What's the matter ? 

Sir And. H*as broke my head a-crofs, and gh'en 
Sir Tohy a bloody coxcomb too : for the love of God, 
your help. I had rather than forty pound, I were at 
home, 

Oli. Who has done this. Sir Andrew ? 

Sir And. The count's gentleman, one Ofario \ we 
took him for a coward, but ht'% the very devil incar* 
dinate. 

DjJc€. My gentleman, Cefario ? 

Sir And. Od's lifelings, here he is : you broke my 
bead for nothing ; and that that I did> I w^slet oq tt> 
do*t by Sir Toby. 

Vio. Why do you fpeak to me ? I never hurt you : 
You drew your 1 word upon oie, without caufe \ 
But I befpake you fair, and hurt you not. 

Enter Sir Toby, and Clown. 

Sir And. If a bloody coxcomb be a hurt, yeu b4« 
hurt me : I think, you fet nothing by a bloody cox- 
comb. Here comes Sir 7(7^j^ halting, you (hall hear 
more 1 but if he had not been in drinis, he would have 
tickled you other-g^es than he did. 

Duke. How now, gentleman ? how is't with you } 

Sir To. That's all one, he ba$ hurt me, and there's 
an end on't -, fot, didft fee Dick Surgieon, fot ? 

Clo. Ohe*8 drunk, S'lrToby^ above an hour agone ; 
bis eyes were iet at eight t*th' morning. 

Sir T'^.Then he's a rogue, and a paft-roesifure Pmin^ 
I \mn ^ 4raAlwi rogue* 

o 4 on. 



200 TWELPTH-NlCHTJ Of, 

OS. Away with him : who hath made this havock 
with them ? 

Sir And. V\\ help you, Sir Toby^ becaufc we^ll be 
drcft together. 

Sir To. Will you help an afs-head, and a coxcomb, 
ftnd a knave, a thin-fac'4 knave, a gull ? 

[Exeunt Clo. To« and And. 

OIL Get him to bed, and let his hurt be look'd ta 



C E N E 

Enter Sebaftian. 



V. 



Seh. I am forry. Madam, I have hurt your kinfmam J 
But had it been the brother of my blood, 
I muft have done no lefs with wit and fafety. 

[Alljtand in amaze. 
You throw a ftrange regard on me, by which, 
I do perceive, it hath offended you ; 
Pardon me, fweet one, even for the vows 
We made each other, but fo late ago. 

Duke. One face, one voice, one habit, and two 
perfons ; 
A natural perfpeftive, that is, and is not ! 

Seb. Antonioy O my dear Antonio ! 
How have the hours racked and tortqr'd nje. 
Since I have loft thee } 

Ant. Sebajlian are you ? 

Seb. Fear'ft thou that, Antonio / 

Ant. How have you made divifion of your felf ? 
An apple, cleft in two, is not more twin 
Then thefe two creatures. Which \» Sebajlian ? 

on. Moft wonderful ! 

Seb. Do I fland there > I never had a brother : 
Nor can there be that deity in my nature. 
Of here and every where. I had a fifter, 
Whom the blind waves and furgcs have devoured \ 

Of 



U^at you nvilL 201 

Of charity, what kin are you to me ? {To Viola. 

What countryman ? what name ? what parentage ? 

yio. OiMeJfaline\ Sebaftian was my father \ 
Such a Sebaftian was my brother too : 
So went he fuited to his watery tomb. 
If fpirits can aflume both form and fuit. 
You come to fright us. 

Seb. A fpirit I am, indeed ; 
But am in that dimenfion grofsly clad. 
Which from the womb I did participate. 
Were you a woman, as the reft goes even, 
I fliouid my tears let fall upon your cheek. 
And fay, *' Thrice welcome, drowned Fiola ! 

Vio. My father had a mole upon his brow« 

Seb. And fo had mine. 

Fio. And dy'd that day, when Viola from her birth 
Had numbred thirteen years. 

Seb. O, that record is lively in my foul ; 
He finiih^, indeed, his mortal adt. 
That day that made my fifter thirteen years. 

Vio. If nothing lets to make us happy both. 
But this my mafculine ufurpM attire ; 
Do not embrace me, *till each circumftance 
Of place, time, fortune, do cohere and jump. 
That I am Viola ; which to confirm, 
ni bring you to a captain in this town 
Where lye my maids weeds ; by whofe gentle help 
I was prelerv'd to ferve this noble Duke. 
All the occurrence of my fortune fince 
Hath been between this Lady, and this Lord. 

Seb. So comes it. Lady, you have been miftook : - 

[To Olivia. 
But nature to her bias drew in that. 
You would have been contraAed to a maid, 
Nor are you therein, by my life, deceived ; 
you are betroth'd both to a maid, and may^ 



402 Twelfth-Night: Or, 

Duke. Be not amazed : right-noble is hU Mood : 
If this be fo, a» yet the glafs feems true, 
I ihall have (hare in this moft happy wreck. 
Boy, thou haft faid to me a thoufand times, [To Via 
Thou never (hould^ft love woman like to me. 

Fio. And all thofe dyings will I over-fWear, 
And all thofe fwearings keep as true in ibut ^ 
As doth that orbed continent the fire, 
That fevers day from night. 

Duke. Give me thy hand. 
And let me fee thee in thy womao^s weeds, 

Fio. The captain, that did bring me firft on (hore, 
Hath my maids garments : he upon fome af^ion 
Is now in durance, at Af^^/Wi^^s fuit, 
A gentleman and follower of my lady^s. 

OIL He (hall enlarge him : fetch Malvolh hither. 
And yet, alas, now I remember me. 
They lay, poor gentleman f he's much diftraft 

SCENE VI. " 

Enter the Clown wiib a letter^ and Fabian. 

^ A moft extracting freney of mine own 
From my remembrance ckarly baniih*d hi^u 
How does he, firr^h ? 

Go, Truly, Madanit he holds Behchub at the tLs^ 
end, as well as a man in his cafe m»y do : b*a$ bene 
writ a letter to you, I (hould have givcn*t you to day 
morning. But as a, mad-man's epiules ^e no gofppli, 
lb k skills not mucb^ when they are deliver'cj' 

OU. Open*t, and read it. 

Oo. Look then, to be well edify*d$ when the fpol 
delivers the mad-man-'^^^^JSjr the Lord^ Afti^iw,^'^'^ 

IfUadt. 

4 A mofttxtneCrngfrinxy^'] I g. A frenzy that drew mc away 
from ever/ thing but ita own objcft. 

ot 



what you mil. 203 



Qfi. How now, art mad ? 

Go. Not Madam, I do but read madnefs : an vour 
JLadyihip will have it as it ought to be, you muft al- 
low Fax. 

OH. Pr'ythce, read it, i'thy right wit»* 

do. So I do, Madona ; but to read bis right wits, 
is to read thus : therefore perpeixi> my princefs, and 
give car. 

OVu Read it you, (irrah. [Tb Fabian. 

Fdb^ [^eads.] By the Lord^ Madamj you wrong 
MTf, and the world Jhall know if : though you have put 
mi into darknefsj and given your drunken Uncle rule 
over me^ yet have J the benefit of myfenfes as weU as 
your Ladyflnp. Ihwoeyour own Letter^ that induced 
me to the femhlance J put on ; with the which J doubt 
not J but to do my f elf much rights or you mucbjhame : 
think ofme^ asyoupleafe: 1 leave my duty a little ut^ 
tbof^bt of^ $ndfpeak oiuVofwy injury. 

The madly u$M Maholio. 

Oli. Did he write this ? 

do. Aj9 Madam* 

Dukei This iavours not much of diftra&ion. 

OK. See him deliver'd, Fabian ; bring him hither. 
My Lord, fo pleafe you, thefe things further thought on^ 
To think me as well a fifter, as a wife ; 
One day fliall crown th' alliance on't» fo pleafe yon^ 
Here at my houfe, and at my proper coft. 

Duke. Madam, I am moft apt t*embrace your ofien 
your mafter quits yQu ; and for your feryicc done him. 
So much againft the metal of your lex, [To Viola. 
So far beneath your (oft and tender breeding ; 
(And fince you caird me mafter for fo long,) 
Here is my hand, you fhall from this time be 
Your mauer*s miftreis. 

Oli. A iiftcr,. you are Ihe. 



S CENE 



204 Twelfth-Night: Or^ 

S C EN E VIL 

Enter Malvolio. 

Duke. Is this the mad-man ? 

Oli. Ay, my Lord, this fame ; how now, Malvolio? 

Mai. Madam, you have done me wrong, notorious 
wrong, f 

OR. Have 1 , Malvolio ? no. 

Mai. Lady, you have ; pray you, perufethat Letter. 
You mull not now deny it is your hand. 
Write from it if you can, in hand or phrafe ; 
Or fay, *tis not your feal, nor your invention ; 
You can fey none of this. WelJ, grant it then ; 
And tell me in the modefty of honour, 
Why you have given mefuch clear lights of favour. 
Bad me come fmiling, and crofs-garterM to you. 
To put on yellow ftockings, and to frown 
Upon Sir Toby^ and the lighter people : 
And a£ling this in an obedient hope, 
Why have you fuffer'd me to be imprifonM, 
Kept in a dark houfe, vifited by the prieft. 
And made the mod notorious geek, and gull. 
That c*er invention plaid on ? tell me, why ? 

Oli. Alas, Malvolio^ this is not my writing, 
Tho% I confefs, much like the character : 
But, out of queftion, 'tis Marians hand. 
And now I do bethink me, it was (he 
Firft told me, thou waft mad ; then cam'ft thoo 

fmiling. 
And in fuch forms which ' here wer* prefupposM 
Upon thee in the letter: pr*ythee, be content ; 
This praftice hath moft flirewdly paft upon thee ; 
But when we know the grounds, and authors of it, 

btr$ nvtre piefuppot'd] Prtfuffoti, for impofed. 

Thoa 



what you nvill. 305 



Thou (halt be both the plaintiff and the judg^ 
Of thine own caufe. 

Fab. Good Madam, h^r me fpeak ; 
And let no quarrel* nor no brawl to come. 
Taint the condition of this prefent hour 
Which I have wondred at. In hope it fhall not» 
Moft freely I confefs, myfelf and Sir Toby 
Set this device againft Malvolio here, 
Upon Ibme ftubborn and uncourteous parts 
We had conceiv'd asainft him. Maria writ 
The letter, at Sir Tobf% great importance ; 
In recompence whereof, he hath married her. 
How with a fportful malice it was followed, 
Mav rather pluck on laughter than revenge \ 
If tnat the injuries be juftly weigh'd. 
That have on both (ides paft. 

OB. Alas, poor fool ! how have they baffled thee ? 

Clo. Why, fome are bom greats fome atcbieve greats 
nefsj and fome have greainefs tbruft upon tbem. I was 
one. Sir, in this interlude ; one Sir T'opas^ Sir \ but 
that^s all one :— ^^ the Lord^fool^ I am not fnadi but 
do you remember, MadsLtnj-^wby laugh you at fucb 
a barren rafcal? an you fmile not^ b?s gagged: and 
thus the whirl*gigg of time brings in his revenges^ 

Mai. ril be revenged on the whole pack of you. 

lExit. 
' OIL He hath been moft notorioufly abus'd. 

Duke. Purfue him, and intreat him to a peace : 
He hath not told us of the captain yet ; 
When that is known, and golden time convents, 
A folemn combination (hall be made 
Of our dear fouls. Mean time, fweet fifter. 
We will not part from hence. — Cefarioy come ; 
(For fo you (hall be, while you are a man \) 
But when in other habits you are feen, 
Orftno^s miftrefs, and his fancy's Queen, [ExeunU 

Clown 



fto6 Tw E LI TH- Night, ^c, 

» « 

Clown Jings. 

* HH^en that I was a little tiny bay^ 

tVitbhey^ te, the wnd and tb$ rain : 
Afoolijh thing was hut a toy^ 

Fwr the rain it rainetb every day* 
But when I came to man*s eftate^ 

Witbbey^ bo^ Sec. 
*GainJl knaves and thieves menjbui tMrgati^ 

For the rain^ &c. 
But when I came ^ alas ! to wtve^ 

fFitbbey^ hoy &c. 
Byfwaggering could I never thrive^ 

For the rainy &c. 
But when I came unto my beds^ 

With beyy hoy Sec. 
fFiih tofs'fots Jim had drunken beads^ 

For the rainy Sec. 
A great while ago the xvorld begun^ 

With beyy hOy &c. 
But tbafs all oney our play is done ; 

And w^llftrive to pUaJi you every day. [Exit. 

6 JThett thai InMu, &c.] Thii wittdiedftdFaot 8bMh^ett\ 
bot the Players ! 




THE 




THE 



C O M E D Y 



O F 



ERRORS. 




^ A 



S A L I N U S, Duke of Ephcfus. 

.^gcon, a Merchant ^Sjrcacufe. 

A.-ki- fn\,c 1 Tvnn-BreiberSt and Sons to 

*^ J unknown to each other. 

Dromio ^£phdia, | t-adnrBraiben^ cmd.Skvtt -to the 
Dromioef Syracufc, J /Wfl Antipholis'j. 
"BaXi^aTM, a Merchdnt, . 
Angelo, a Goldfmitb. 

A Merchant^ FnEearf./ff'AnMpholis^jSyracuIe, 
Vr. Finchi a Scbeol-mafter^ and a Conjurer, 

■ .-. : ..:^ . ■ ■-■'.,: ' , \'.^ s-i .-.a 

Emilia, IFife to M^eatif MASBifs afE^uSa, 
Adriana, H^tfe to AntiphoUs o^phefus. 
Luciana, Sifter to Adriariai '. ;. 
Luce, S^rt"*!*/ ft Adf iana; ' ....■_ 



yfiiloTy Officers J a»^ other ^Ji 



r^ 



'it 



THE 

COMEDY 0/ ERRORS. 

ACT I. SCENE I. 

the Duke's Palace. 

Eiatr the Dukt of EphcTus, JEgeon, JaUory and 
ttber AttendoMSt, 

J R O C E E D> j'd&w, to pracure m7 AD, 

I Duh, Merchant ot Syraa^tt plead no 

* I am not partial to infringe cur lawi : 
The eoroity* and difcord, which of late 
Sprut^ from the lanc'rous outrage of your Duke» 
To oierchaiiES, our well-dealing coaatryoKO, 
(Who, wanting gilders to redeem their lives. 
Have leal'd his rigorous ftatuto with their bloods) 
Exckides all pity from our threatning looks. 
For, fince the mortal and incefiiiie jars 
Twixt thy iedkious countrymen and us, 
y, hath in Iblemo fyuods been decrcod. 
Vol.. IIL P Both 



2IO lie Comedy of Etmoii*! 

^oth by the Syracufans and ourfelves, 

'Padmit no traffick to our adverfe towfll 

Nay, more ; if any born at Epbefus 

Be feen at Syracufan marts and fairs. 

Again, if any Syracufan born 

Come to the bay of Epbefus^ he dies : 

His goods connfcate to the Duke*s difpofe» 

Unlel's a thoufand marks be levied 

To quit the penalty, and ranfom him. 

Thy fubftance, vdu^d at the higheft fate^ 

Cannot amount unto a hubdred marics ; 

Therefore, by law thou art condemned to die. 

" JEgeon. Yet this my comfort, when yoor wordt are 

done. 
My .woes ehd likewife ^!th the evening fiirt. 

Duke. Well, Syracufarij fay, in brief, the cauie. 
Why thou departed'ft fix)m thy native home j 
And for what caufe thou earned to Ephefus. 
• jEgeon. A heavier task could not have been imposed) 
'i'han I to fjpiak my * grief Unfpeakablc :' 
Yet that the world may witnefs, tliat my eod 
• Was wrought by nature, not by vile on<;nce» 
ril utter what my forrow gives me leave. 
In Syracufa was I "borft, and wed ' * 

Unto a woman, haf^py but for mc; 
And by me too, had not our Kap beien bad : 
With her I liv'd in joy -, our wealth incrdis'd, 

t Was womiht by naiun, not ly vile offitidtl All his hcaim 
anderftoo4 that the panifliment he was abo6t to unclef^ was m 
ooofequeh^e of no private crime, bat tjif the fiofa^ck eamity be- 
tween two ftates. to one of which he belonged : But it wa$ a gOKttl 
faperfticiodamongft the aiici^nt8» that every great and fodden mxf- 
fortune was the vengeance of heaven purfuitig men for their fecret 
offences. Hence the fentifnent here pat into the moath of Ae 
fpeaker was proper, iy my paft life, (fayf he) whfdi I am tooiBg 
to leiate, the world max nnderftand that my prefent death u ac- 
cording to the ordinary courfe of previdence, [wroHghi if ndtari] 
and not the efft^s of divine vengeance bvenakihg me for siy 
crimes, [««/ fy *viU offend:}- 

By 



i 



By profperous Koy.wp I often piade 
To Eptdamnum i 'tul mj fa,^or's death. 
And the great care .of gOG^s at randpm left. 
Drew me from kiqd eml>niceineats of my fpouie } 
From vhocn mj abfeoce w^ not fix mondis old, 
Before hericlf (al^oft at iaiptiog under 
The pleafiog ppnifl^fnent that wotnea bear) 
Had made prpvifiqa tqf, h^r .following me^ 
And fbon, aod iafe, arrived where I was. . 
There Ihe hjui ooc b^eo long, but ihe becacne 
A joyful oiQ^her of two goodly fons ; 

And, which ,1^^ ft^^^'^!^ ^^^ ^^ ^^^^ theother^ 
As could not^ije didingMi^M but by names. 
That very liour, and ip the fclf-iamc inn, 
A poor me%a woipaff w^ delivered 
Of fucb a i)^rtb^, male-twios both alike : 
Thofe (for their par^nt^ were exceeding poor) 
I bought, an4 .brought up to attend my Tons. 
My wife, not i^f^anly proud of two fuch boys. 
Made daily motjops for our home-return ; 
XJnwiliing, I agreed ; alas, too foon ! 
We came a^xiard. 

A league from Eff^pfnnum had we fail'd. 
Before the always-wind-obeying deep 
Gave any tr^gick inftance of our harm i 
But longer did we not retain much hope : 
For what jQb((;pred light the hqtv'ns did graot» 
Did but convey unco, our fearful minds 
A doubtful warrant of immediate death ; 
Which, tho' myfelf would, gladly have en)b)rac*d. 
Yet the tnceilant weeping x>f my wife, 
(Wecpixng before, for what ihe faw muft come %) 
Andjpltequs plainings of the pretty babes. 
That. mo^;i'4.for faibion, ignorant what to fear. 
Forced me to &ek delays for them and noe : 
And this it was ; (for otb^ means were none.) 
'The iailors fought for iafety t^y our boat, 

■ P 1 ' ' * And 



r-4 



2 1 2 The Comedy {of E BiltO 

And Ifift jhe.fiiip, then fmking^ripeivmi^Si' 
My wife, "more careful for iheeldw bocrt)' 
Had faften'd him unto a fmaU fpitrtt-;idAft^ •. 
Such as fea- faring men provide fiKsihitQPft'i v A 

To him one of the other twins wt» bomd^^: - 
Whilft I had been like heedful of the efeber. : 

The children thus difpos'd* my wife and I^ 
Fixiog our eyes on whom oui^ care wiis* £tt) 
Faften*d ourfelves at either end the maft;i ^ri; . jO 
And floating (Iraight, obedient to thttilblMlihf' isriV/ 
Were carry'd towards CariBib, as W;^ t^HVg^/'^^ 
At length the fun, gaiiii^g ppon thf Wfd/k^ /.iHgi** ^A 
DifpcrsM thofe vappurs \t!^t oSeod^-m^%' * . i -:; 1 A 
And, by the tjepefit of bis wi(h\i lin^*^ isrlT 

The feas wa^ calm \ and we difcovcnoii ^ / it^H 
Two (hips from far making, amain to HSur/c^ jr^gil/ 
Of Corinth that, of Ejndaurus this; : -"i . '^ rM^^^ 
But ere they camc-r—ob, let me fay m.criQttL .iH I 
Gather tljc^f<?quel by chat wentbefoi^e^ -ii r/> ^viH 
Df^^<?! Nay, forward, old nun^do noibhmki^l^^ 
For we may pity, tho* not pardon tJwJc^.ijr' br.A 
^^if^n, Qh, had the GodsdOD^ fciyilt0kiMII«lQ^ 
Worthily term'd them mfarcilefs ^ mit. - j / - lO 
For ere the (hips could meet by tiniiTn.fimir)rtipinif M 
We were encountered by a mightf iwll>.qi - r^.A 
Which being violently borne upon#. ^- vr^ '^» 
Our Mp)^& ihip waa fplitted m theitwM^: .^ 1 
So that, in this unjuft divorce of us,. 
Fortune Jvid left to both of us alike ^ v.- . /. 
What iq delight in, what to forrow fiari -M ■ • , 
Her part, poor foul ! feeming as burdened- * 
Wkh leffcr weight, but not with leflfer iffoe^ \A 
Was carry'cj with more fpeed before the wiodl^ : 9 
And in our fight they three were taken up.; . * A 
By filhermen of CorinA^ n we thougbe, .3 

At length, another dhip had fciaM on us ^ ' Y 
And knowing whonjit^witf their-bipx«o>fiw«i ^ I 

Ga« 






«' X 



Gave hclpfijt^Clfcotns ttj' iMt fhipwreckt gacfts j 

And wouIdclUIV« f«ft €h« fi/h^rs of their prey. 

Had not thaili4nrk 4KeA^ v^ry flow of fail ; 

And chere£btVtfMmKwaR3 dfd thty bend their couric. — 

Thus have fWPAeArd itie (eVer'd from my biifi % 

That by ifdiferruties wa^^my life prolonged. 

To tell fad-fl»te3^bf my own milhaps. 

Duke. Afikjj'for the fak^ of them thou forrO^*ft for> 
Do me the fiivour to dilate ^ full 
What htfkf tUfeU^ of th€m; and thee, 'rill how. 

Mgei^S^Hfr youngeft fc^y, ahd yet my eldcfrcarc. 
At eighteencf^km became imjuificive 
After bis brMliel»9 andinri^rnin'd me. 
That his atteid^t, (for hi^ cafe was like. 
Reft of his imttre)*, but retained his name,) 
Might beaft^tlini? company hrqueft of hinft ^ 
Whom whilft I laboured of a fove to fee, " 
I hazardedohe lofS; of whom I lov'd. 
Five fummcrs hsnrie I Tpev/t in ftrtheft Greece^ 
JbiftAilipVfeimuhmdgh the bounds of Ajra^ 
And coaftinjg:>tl6tiieward, came to Epbefus : 
ti0|)l(tfs(¥0%d}t «|ertoth to leave unfought. 
Or that, or anf p«(^K that harbours men. 
BuirtwyifciWftitfnd-the ftorjr of my Kf^ % 
And happys #%t« I^in my timefy death, 
CouM all my traiw)s watfiint ihe they live. 

Luke, rwpftftn^;^^, WbbrH the fates IjaVe markt 
To bear th»extrttt)ity of^tre' tttffiap*, '^V ^^' 
Now, truft me,'4litek nbt^againft oiii* laWs, 
(Which Priilrits;-^«W)ul<Plta%>'may not difeflfttt! %) 
Againft iitf fci^ivfi, myVfirtf,^ Aiy di'gnftyi '':^i 
My foukftro«»*e« ad¥ba«fc fdr thfc.'^'^'^ ' ^* * 
But, jJbii^Hhdb m adjudge 4!b>t{i(rde^ttr/'^ ^ 
And pafli^i fefttciice maj^^cir bg ¥e«iB*a; ^ 

?ut to bur Mik8iur*s greats djij^rkgemirit ^"^ 
xt will L filvour thee in <^hat^ I carl ; •- 
I theitMevtdffChant, limit il^^ this da/; 
^'fio P 3 To 



^14 lie Comedy of ErUors* 

To feck thy life by beneficial' help: 
Try all Ac friends thou haft in Epbefhiy 
Beg thou, or borrow, to make up the fum. 
And live ; if not, then thou art doomM to dfc. 
Jailor, take him to thy cuftody. 

[Exeunt Duke^ and Train. 
Jail. I will, my Lord. 
. JEgetm. Hopclefs and hdplefs doth ASgeon wend. 
But to procraftinate hb lifelefs end. 

[ExeUnt ^gedfl, And Jailor, 

SCENE II. 

Changes to the Street. 

Enter Antipholis of Syracufe, a Merebantj and 

Dromio. 

il/rr.'T'Hcrcfore give out, you arc of Epidammm^ 

X Lied: that your goods too ibon be confifauie. 
This very 'day, a Syracufan merchant 
Is apprehended for arrival here j 
And, not being able to buy out his life. 
According to the ftatute of the town. 
Dies ere the weary fun fct in the weft : 
There is your mony, that I had to keep. 

Alt. Go bear it to the Centaury where we hoft. 
And ftay there, Dromio^ 'till 1 come to thee : 
Within this hour it will be dinner time ; 
'Till that Pll view the manners of the town, 
Perufe the traders, gaze upon the boildings, 
And then return and deep within mine inn ; 
For with Jong travel I am ftift* and weary. 
Get thee away. 

Bro. Many a man would take you at your word. 
And go indeed, having fo good a means. 

{Exit Dromio. 



jfMt. A trufty villain, Sir^ chat very oft. 
When I am dull with care and melancholy, 
Lightens my hufnour with his merry jefts. 
What, will you walk with me aipout the towi^ 
Aod tbep go to the inn and dine with me? 

Mer. I am invited. Sir, to certain merchants. 
Of whom I hope to make much benefit : 
I crave ypm* pardon. Soon at five o' dock, 
Fleaie you, Pll meet with you upon the mart. 
And afterward confort you 'till bed-time : 
My prefent bufinefs calls me from you now. 

j£a. FMewel 'till then ; I will go lofe myielf. 
And wander up and down to view the city^ 

Afer. Sir^ I commend you to your own content 

[£m^ Mercbank 

SCENE ffl. 

jha. He ihac commends me to my own omcqaty 
Comsmads me to the thing I cannot get. 
I to the world am like a drop of water. 
That in the ocean feeks another drop. 
Who falling there to find his fellow forth, 
Unifien inquifitive, confounds himfelf : 
So I, to find a mother and a brother. 
In queSt of them, unhappy, lofe my&lf. 

Enter Dromio of Ephefus. 

Here comes the almanack of my true date. 
What now ? bow chance, thou art returned fo ibon ? 
E. Dro. Returned fo foon ! rather approached too 
late: 
The capon bums, the pig falls from the fpit. 
The clock has ftrucken twelve upon the bell ^ 
My qfiiftrcis made it one upon my cheek ^ 
She is fo hot, becaufe the nieat is cold ^ 
The meat is cold, becaufe you come not home s 

P4 You 



You Goocjodt hofne^'tMRMfc yoo hiive no ft^mach ^ ' 
You have noiftomadi, havtlng broke yoar £ift : 
But we, chtfi^coow what ?tb to fall' and praf. 
Are {)efiieti]t for yoar defirott to day. 

jA/^ ^op in your wind. Sir ; telt me tbit^ I pray» 
Whece yoQ harve left the mony that I gave ymf ? ^ 

£ Dro. Oh,*--fix-pence, that I had a ff^mfiU^ lafl^ 
To pay die fadlcr for my miftfcft* cmpperf ' ^ 

The fadkrkul k, Sir^ I htpt it nbt, -^ ' 

Ant. I am- not in a fporrive humour new) '' . : : ^ 
TcH mc and dally not;-whert iathe cnohy^ >. 
We being ftrangers here, how dar^ <iibiMiti(l 
So great axt^arge ftoha thine own^oiftodyf '''^Vi 

JL Dra: - 1 ^ray you, jeft. Sir, as you fit at dinner : 
I from cry ^mtflrrii came to- you in^ pofti; ' 
If I return^ I fhall be poft indeed ; > > ' r i 

For {he wiltifixm your fiuik upon my patens * T "" 
Methinks,. your inaw,. like miiie, Ihould be ^our dock^ 
And ftrike you home without a meflenger. 

JSi/Cpme, Drm/^,. come, tHefe kfeir^^ 

Rcfcrve them 'till a merrier hour th^»ijhil:vrx?j Jv-^ 
Where is the gold I g^^vtf in trhargeto tfttef* ^^ • 

E. Dro. to me, Sfr ? why, )^6a^^e fto k^ me. 

jitti.Coxnt, on. Sir kng'Ve, have doqe ypiSi^tooliltvK^; 
And tell me, -how thou haft difpos'd^jiysdhargcr:^ iv> 

E. Drd. My charge was but to fetclf you ^ftbJfti jAc 

^^^ : ^' - W ' •'-«" 

Hook; CO your boulc, the Pimmx^ ^4 to^nn^er.^v^ 
vMy miftrefc and hei^ fifter ftay <br yotfp •^'^ lut tMn" 

yft/, Nbw, as 1 ^m a cfiriftian anfwcr tT*(?, 
: In what fa fe place yoti najrc bcftow'd niy'mony 5 
Or I (halj br^ that Hierry fconce of yours, 
That Hands on tricks when Tarti'undifpos'd 5 ■ * - 
Where are the thoufand miarKS^tHou hadft of me? 

E. pro. I have fame ttisixks qt^burt upon my pate > 
Some of my miftrefs' marks uppoiiiy^&oukla^;- * 

But 



But iMitiaitiiOttfiuuirlnnrksibco^^ AxMh^m^^ji 
If I flionid jfB,y^ ]fioiu^:W9iifliipi ttitA-nffin^.. v-. ^J r' 
Ferchanor^ }90U wiB jkc hotf them puehdyuj « >> 
jfm. Thy miftttfi' odasks.? wmr aiiiMBi.'4Iayc^ 

E. Dno, Youf wodbip's wife, my mUrap Ja:^tke 
Sk€y thai dotb &ft« 'ciU jojn cemo bcmr 4o diAner ; 
And prays, tbut you will hie you home to dinner. 

jfra. What wik thou fioit me thus uotoiflolf faoe^* 
Being forbid? chepe take you^thac,. Sir knavte, * 

M. Drd, W^t mean yoii^ Sir? for God^Jkke^ hold 

Nay, an y^irntitt^ not^ Sr, i'jyi take m]!( iieds; 1 
' - -I. n-' "v ,» {£x£itflr6ibio. 

Ant. Upptt'jq^ Jife^ b]^ fiwae dericeionx3dieo(> 't ^ 
The villain is o^er-wroughf! nf all imyt dioa)u ^ ^ ^ 
• They £qr$/thfrtowQ is ;fuU of «)iiaccKlgbf ' rf^ . 4 
;^?tAK% niinl^lfijoggkr^ thattkscqvetfae eyeei'' 'ij. ^ 1 

tT^Skt life aifeieirti give of icV Hence F^e0'/«t i>A^i^ApijL^tx% 
was proverbial amoogft them. Thm MinoBier ufe^ if, & *£ss0-^^ 
^p<^/xfe«}«^»iiiidicrfiuiieieilfe. "'':^' _ 

5 iff, iliwAll^n^l^s^ that diciivi ihnejii • . V 

• J?vk- working yir«r#r/, that cbcai^ tbt pitmh ,, , • a 
^:^ ^S«/-lfi/Sfif«^ ^kchis^ fbttt deform tbt Mji] ThokwiiO. atteii* 
'ffAiy odd^Mer iMe t]ii«e lines, maft coiifeOi chat tke Poet inten- 
ded, thctpitbe^ givfai CD each of thefe mifotantt, ihootd decka-e 
tbe ipwer by^ wmch they poFform, their fcat8» a^ yJrich woald 
tkerenre be i jaft charafterifttck of each of thrm. Thiis, by 
mimUi jugglers, w are tauffht tha^ they perform their tricks by 
Ji^ cfiMi^: 9!oA )^y fifd-kWing midhitt^ ive $tt itArtu'd^ tlie 
iDtfcUef they d^ ii ^ the ftSkmct of the deviU.«>:>Khon^^ Niey 
hare gitrea thdr/ottls: But then, by iori-wtriitf ^orccren, we 
are not inllraded in tlie means hy which they pemrm their en^a. 
Befidts, this epithet Agrees as well to witches; astp them; and 
therefbre, oartnnly, oor author ooold not defign this in thair cha-* 
ladertftick. We ihouidreadt 

Drog-wprking /&r(«rfr/» that clf4U^i ibi mufdj , 
And we know by the hiftory of ancient uid modern fopsrftitiont 
that diefe kind of jugglers always pretended to work changes of 
tbe mind by iheb applicaiioni. 

J Drug« 



2i8 tie Comedy cf Errors. 

Drug-working ibrcerera, that change the mind ; 

Soul-killing witches, that deform the i^y i 

Diiguifed cheater^, prating mountebankSt 

And many fud) like libertines of fin : 

If it proYe fo, I will be gone the fooner. 

ril to the dntaur^ to go feek this (lave ; 

I greatly fear, my mony is oot fafe. \ExU. 

ACT II. S C E N E L 

^be Houfe of Antipholis of Ejrficfus. 
Enter Adriana and Luciana. 

Ad RI A N A. 

NE I T H E R my husband, nor the flave return^. 
That in fuch hafte I fent to feek his mailer! 
Sure, Luciana^ it is two o* clock. 

Luc. Perhaps, fome merchant hath invited him. 
And from the mart he*$ fomewhere gone to dinner: 
Good filler, let us dine, and never fret. 
A man is mailer of his liberty : 
Time is their matter ; and when they fee time. 
They'll go or come ; if fo, be patient, filler. 

Adr. Why Ihould their liberty than ours be more? 

Luc. Becaufe their bufinefs ftill lyes out a-door. 

jidr. Look, when I fcrve him lb, he takes it ill. 

Luc. Oh, know, he is the bridle of your will. 

^dr. There's none, but afies, will be bridled ib. 

Luc. Why, head-ftrong liberty is lalht with wo. 
There's nothing fituate under heaven's eye. 
But hath its bound in earth, in fea, in sky : 
The beads, the filhes, and the winged fowls. 
Are their males' fubjefls, and at their controuls : 

Maoj 



The CdtneJy af E Kit OK s. 219 

Man 9 more divme, the mafter of all thefc. 

Lord of the wide world, and wide wat'ry feaSt 

Inda*d with intelledaal fenfe and fool. 

Of more preheminence than fifh and fowl. 

Are tnafters to their females, and their lords: 

Then let yocr will attend on their accords. 

Air. This fcrvitade makes yon to keep unwed* 
Lttc. Not this, but troubles of the marriage-bed. 
^dr. But were you wedded, you would b(ar fome 

fway. 
Luc. Ere I learn love, I'll praftife to obey. 
jidr. How if your husband ftart fome other where f 
Luc. 'Till he come home again, I would forbear. 
Air. Patience unmov'd, no marvel tho* Ihe paufe i 

They can be meek, that have no other caufe : 

A wretched foul, In-uia'd with adverfity. 

We bid be quiet, when we hear it cry ; 

Bat were we burden'd with like weight of pain. 

As much, or more, we fhould ourfelves complain. 

So thou, that haft no unkind mate to grieve thee. 

With urging helplcfs patience would*ft relieve mc : 

But if thou live to fee like right bereft. 

This fool-begg'd patience in thee will be left. 
Imc. Well, 1 will marry one day but to try ; 

Here comes your man, now is your husband nigh. 

SCENE II. 

Enter Dromio of Ephefus. 

jtdr. Say, is your tardy mafter now at hand ? 

£. Dro. Nayl he's at two hands with me, and that 
my two ears can witnels. 

jidr. Say, did'ft thou fpeak widi him? know'ft 
thou his mind ? 

E. Dro. Ay, ay, he told me his mind upon mtneear. 
Beihrew his hand, I fcarce could undeivrottid it. 

Luc: 



220 ThiCame/fyjfEiLSLovis^i 

Luii Sg^ heib doubtfully t .thou coubd*fbnot foeK 

B^Vro. Nay, he ftruck fo plainly, I could too well 
feel his blows ; and withal fo doubtfully, that I could 
Icarce underftand them. 

Adr. But (ay, I pr*ythee, is he coming home?^ 
It feems^ he hath great care to pleafe his wife. 
E.'Dro0 Why, miftrefsi fure, my mailer is horn-mad^ 
Mr. Horn-mad, thou Tillain? \ 

E. Dro. 1 mean not, cuckold-mad ; but, furei he^ 
llai4cmad: 
When I defir'd him to comfr home to dinner. 
He ask*d me for a thoufahd marks in gold: :\ 

'Tis dinner-time, quoth I ^ nfry' gold, quoth he : 
Your meat doth burn, quoth I $ my gold,^uoch htif. 
Will you come home, quoch I ? my gold,- qoodi hei^^ 
Where is the choufand marks I gave thee, viUain? ^ 



1 




thy , ^ 

Luc. Quoth who ? ^ — ' ^^ - 

E. 1>ro. Quoth my matter : "^"^ ^ 

I know, quoth he, no hoofe, no wife, no itiffirefi^' 
So that my errand, due onto my tongder, "p ' ^ 
I thank him, I bare home upon my ffidUuei^^ '' '^ 
Jbr, in conclufion, he did beat me there. ^^^ - " "^^ 
Air. Go bick again, diou Qavcl'm'^MAim 

E. Dftf.vGo back again, and be new Ijeto'htf!^ 
ForGod's fake, fend ^ortiebthermcfiehgei^P^ *^^* 

Mr. Back, flave, or I will break thy pate acrofs. 

E.Dra. Aiyjl, he w^iri^s thai; t^6fe'%^i||i\pther 
oeating* _ - i- jr -^ - z -^ : j-j . v^^^-^i© 't*^'^ 
Bttweeo you jTibaUlwvja holy head^^^^-^^'^^^ 
' ^r^ Hence, pxan^pkMfent^ietchfhy^^ 

£. Dfik ^tM lib round with yod kl'^ii^ witVme, 
That like » bK^trb^^ 



The Qomeipf of £ {tRoiL&»'' 221 

Y<N1 fparn irte heBce« and he wiH fpum itid^ijdier: 
If I lafi Id this ferrioc, you muft cafe me'' ip lAfl^er. 



^ ' 



SCENE Hk i:^ . . 

Zmc. Fietl Kow ImpatieoQc.f lowrisih in your &ee ( .' 
^dr^ His company mufl: 4o hi9 miniow graoe, 
Wbilft i at home ftarve fv a wcrry look : 
Hath homely age tb* alluring beauty t^ok 
From my poor cheek ? then, he hath wafted it. 
Are my di^oiirie$ dull ? barren my wk ? 
If voluble^Qjijl iWr^ difcourfe be marr'd, ^ . 
Unkin^^.^funts it,, more than marble hard* . <t. 
Dpjtlj^ijc ga^[^clliM > 

T3ia('^,B^n^r^ult; bVsrn»after <^ my ftM«< v ! 
Wj^jf}|4^5l5Qma»c, th4C.can be foocKJ i^ r » 
By ljp^ft5 J^^^ then* is he the grcftifid^. , J 

Buty too unruly dear, he breaks t^e pale, : ^ 
And feeds from home ; jQQr.I;M^but|iis ftalv«/A 

tr. Unre^mgfi)o|«cw^it)ljR]ch^ 
I knpw^fk^ffi^^.d^^ hQmagR>«tJwfr»«^kep^ii:i . i. ^ i 
Or cite what %f it, bu£ b^ ^«^^J4 be hg^Oc^^:. ., T 

>«i; he prooiisM fiM^a cba||i <k) 'mV\ 
1^ alone, he wo^d detai%H>'' 





bed emspdolk 1 1 .• -■>) >'l 

nmt tbers touch, and ^ai toucbiitz qyilf • ' 

Br ff//6md,fM4f tnrtiptioM )iffkJtJkmi} to dfii iflSftable 
caodidon is this paflkg^ givea 1^. St fl^qa^< be |||id dnpf}^ ^ 



s 

s 



222 7hi Cwaedy of Ei^Roiis. 

Will Jofe his beauty ; ^uid the gold b^es^UI^ 
That others touch ; yet often toucbiqg will 
Wear gold : and fo no man, that hath a name. 
But falfhood, and corruption, doth it ihame. 
Since that my tieaucy cannot pleafc his eye, ^ 

I'll weep what's left away, and weeping die. > 

Lm. How many fond £x)ls fer ve mad jealoufie I 3 

[Exeunt. 

S C E N E IV. 

Changes to the Street. 

Enter Antipholis of Syracufe. 

JnL T^ H E gold I gave to Dromo is laid up 

X Ssiftvittht Centaur ; and the heedful (lave 
Is wander'd forth in care to feek oae out. 
By computation, aod mine hoft*s ceporc, 
I could not fpeak with Drsmio^ iince at ficft 
I fent him from the.mart. See, here he comes* 

Enter Dronuo of &y racufc. 

How now. Sir ? is your merry humour altered ^ 
;As you love ftrokes, (b jeft with nut again. 
You know no C^«/ii«r ? you reccivM no gold? 
Your miftrcfe fent to have me home to dinner? 
My houfc was at the Phignixf waft thou mad. 
That thus fo madly theu didft anfwer me ? 

S. Dro. What anfwer, Sir ? when fpake I fi^ a 
word ? . . • 

77?at others touch ; yet often touching nmlt 
Wear gold : and Jo no man, that hath a name^ 
But faijhoodf and corrupt ion , doth it/bamt. 

The fenfe is this, '' G(M» Indeed, will long bc&rtke hindliAgi 
'* however, oTccd /authingf will wear even gold ; juft fo the 01^ 
*' e(l charader, tho^ as pure as gold itfelf, may, in time, beia- 
<* jured, b/ the repeated attacks of iaiihood and corruption.** 

Ant. 






The Gmedjr (f ViKKOKSk 223 

;0iiHi. EtFeh THHT) even herc> not half an hour fiace. 

S. Dro. I did not ice you lince you fent me hence 
Home CO die Centaur j with die gold you gave me. 

jfn/. Villahi) thou didft deny the gold's receipt i 
And told*ft me of a miftefi, and a dinner % 
For which, I hope, thou felt*ft I was difpleas'd. 
. S. Dro. Pm glad to fee you in this merry vein : 
What means this jeft, I pray you, matter, tell me ? 

yfnS. Yea, doft thou jeer and flout me in the teeth f 
Thiak'ft chou^ I jeft ? hold, take thou that, and thac 

[5^^iDro. 

S. Dro. Hold, Sir, for God*s fake, now your jeft 
is earneft ; 
Upon what bargam do you give it me ? 

Ant. Becaufe chat I familiarly fomecimes 
Do ufe you for my fool, and chat with you. 
Your iawcinefs will jeft upon my love. 
And itaake a common of my ferious hours. 
Wheh the funfliines, let foolifh gnats make fport^ 
But creep in crannies, when he hides his beams : 
If you will jeft with me, know my afpe<% 
And fafhion your demeanour to my looks ; 
Or I will * b^c this mecbod in your fconce. 

S. Dro. Sconce^ call you it ? fo you would leave 
battering, I had rather have it a head ; an you ufe 
chefe blows long, I muft get a fconce for my head, 
mnd infeonce it too, or elfe I fhall feek my wic in my 
flioulders : but, I pray. Sir, why am I beacen i 

Am. Doft thou not know ? 

S. Dro. Nothing, Sir, but that I am beaten. 

Ant. Shall I cell you why ? 

S. Dro. Ay, Sir, and wherefore i for, they fay, 
every why hach a wherefore. 
. . Ant. Why, firft, for flouting me ; and chen where- 
fere, Ibr urging it the fecond time to me. 

htat thU method J Method ^ for inflradifti. 

^. Dro. 






224 ^ Comdj^ of Errors* 

S. Dro. Was there ercr any man tkut beaten oar of 
fealbn. 
When, in che why, and wherefore^ it neither rhtnt 

nor reafbn ? 
WelU Sir/ I thank yon. 

Alt. Thank me. Sir, for what ? 

S. Dro, Marry» Sir, for this ibmething that yoo 
gave me for nothing. 

Jnt. ril make you amends ne3tt, to gire you no- 
thing for fomeching. But fay, Sir, is it dinner-^me i 

S.Dro. No, Sir, I think, the meat wants that I hare. 

Ant. In good time. Sir, what's that? 

S. Dro. Bailing. 

jlnt. Well, Sir, then 'twill be dry. 

S. Dro. If it be. Sir, I pray you eat none of k. 

jini. Your reafon ? 

f . Dro. Left it make you cholerick, and puichafe 
me another dry-bafting. ^ 

Ant. Well, Sir, learn to jeft in good times thercfs 
a time for all things. 

S. Dro. I durft have deny^d that, before you woe 
fo cholerick, 

Aitt. By what rule. Sir i 

S. Dro. Marry, Sir, by a rule as plain m the pkio 
bald pate of father 71m< him&if. 

Ant. Let's hear it. 

S. Dro. There's no time for a man to recover fak 
hair, that grows bald by nature. 

Ant. May he not do k by fine and recovery f 

S, Dro. Yes, to pay a fine for a peruke, and recora 
the k>ft hair of another man. 

Ant. Why is fime fuch a niggard of hair, being, as 
it is, fo plentiful an excrement i 

S. Dro. Becauft k is a blelling that he beftows oo 
beafts I and what he hath fcanted men in hair, he hath 
given («) them in wk. 

Anti 



than wit 

» S Dr^. Ndk a ntan of chofcj but he liath the wit to 

Jofe his hair. ^ . , 

^»/. Why^ thou drdft conclude hairy men pjain deal* 
crs without wit. 

^ S^ Dro. The plainer dealer, the fooner loft ; yet he 
loleth it in a kind of jollity. 

jfni. For what reaton ? 
• *^i Dro. For two^ and found ones too* 

jfit^ Nay, not found, I pray you, 

S. Dro. SuVeones then. 

-A/. Nay, not furc in a thing falfing* 

^. Dr^. Certain ones then. . ,*'* 

Jtni. Name^thent. / . • - ' . 

S. Dro. The one to fave the Wney that he Jpifcpds 
ttvying \ 4h^btber, that ^t difii\er they (K6ukl 4)Qt 
drop in his porridge, • ^ ' ; . ' t ^' 

<*;:^dk^ Ym'^As^iWI all tkii tinie hare "^ror*^; t^ert is 
no time for all things* . : • -j : .^ * 

W5»r J&W *4ArfV# artddkli 5Sri namdy^ no tJnife to 
recover hair loft by nature. ^ * . * * 

^/r/. But yourreafon wals hot fubftantial, wh^'^ere 
ir^iQ tiin^itc^ rltioi^h \ . • . " .^^^'^ \ 

S. Dro. ThusI menhir-Time hjmfelf is baHi^nd 
therefore to the world's end will hrfrebalc^ foHojVn^. 
tii^ftr^ l'l8haar^^'tW(Kikl*l!SenfcMdconthafiS^ but^ 
foft ! who wafts us yortdcrf / ' -'^ v '^' . ^ ** 






. ^ £»fer Adriana, ^^d Ijfdzn^ . _ / .v \ 

Jdri. Ay, ay, Jniipb^^' look ftrarifee iind fro^dy 
Mrti^oth^r nrAftrefs hath thy^fweet«pc6K: '' ^ " 
lltirt ^tAitianai nor thy ^Ift. - ^ ** * - ^ ^ "^ 
The time was once, when thou, irfitlrgVl, wouUlk raWf 
^ That never woackwck^imufidMsdiiildqiiVk .*' 
^ Milfoi-. III. (i * That 



Ys6 tffeikmdy ^ £iiiLblii» 

^ Thtt neTier cbjeft plcaftng in thiM (7^^ 
^ That never touch well welcome to thy hand, 
« That never meat fwccc-ikvoutM in thy taftfe, 
• Unlcfs I .fpake, or looked, or touch'd, or carv^fl. 
How comes it now, my bUBband, oh, how comes k^ 
That thou art thus eftranged from thy ief f ? 
Thy (elf I call it, being ftrange to me : 
That, undividable, incorporate. 
Am better than thy dear felf's better part. ^ 

Ah, do not tear away thy felf from me : 
For know, my love^ as eafie may'ft thou fail 
A drop of water in the breaking gulph. 
And take unmingled thMce that drop again^ 
Without addition or dinoffiifliing. 
As take from me thy felf; and not me too. 
How dearly would it touch thee to the qukk, 
Should^ft ^ou but hear, I were licentious ? 
And that this body, confecrate to thee. 
By ruffian loft (hoold be contaminate ? 
Would'ft thou not fpit at me, and fpum at me. 
And hurl the name of husband in my &ce. 
And tear the ftain'd skin of my hark>t-brow, 
And from my fklfc handdUt the wedding-ring. 
And break it with a deep-divorcing vow ? 
• I know thou canHl ; and therefore, lee, thou do it« 
' I am poflefs'd with an adulterate blot ; 
My blood is mingled with the Grime of lufl: : 
For if we two be one, and thou play falle, 
I do dieeft the poiibn of thy flelh. 
Being urumpetoj by thy contagbn. 

^ lam ^ffeflitwith an aitdtiratt blot \ 

Mf hUod u mingUd iviih tbi cr i m K tfiuft :3 Both tlie into- 
grity of the metaphor, and the word Hot^ in the pitoBding lin^ 
Slew that we (hould read, 

nxtith ihe GKiu^o/ luft : 1. # the Jfain, fmut. So a- 

^ain in this pkty,-*-^^ mam mu^ i§ vvtrjkm in -Ai oai me afk. 

Keep 



7^ Qftmiffif Eeroas. 227 

Keep then &ir JoAgpr, and crupe witbiiiy O'ucbcd i 
I livf lijftijo^d, chofi undiil^ooQuiicd* 

Ant. Plead ydOMCQ oic, fair da«ne ? | know you not : 
Ux £ti>^fitsluxxhfotx»QhouT^o\d^ 
As ftrange unto your town ,as to your talk. 
W&iy cfjergr vkm^ by aU my wit bcang fcann^c!. 
Wants wjt in ali one woBd co under^d. 

JJu. Fic» faoDlhcr I how the world is changed with 
you I 
WheA were you wont to Aife my After <hu8 ? 
JMe fenc fiir yoii by Drpmio botnc to dinner. 

Jtif. Bf Drotmf 

S.Dr0. BjTfae? 

Jblr, ft^ 1^ ft acid thus thou didftmurn from him^ 
That he cfid bufl^thfie i and in has blows 
fieoy^4 fixy bovic for his, me for his wife. 

jit» Did you oonvecfc, Sir^ with this gentle* 
woman ? 
What is tbf counfe and drift of your compaft ? 

S. Dro. I, Sir, I never faw her 'till this time. 

jtni. yHlaint thou lieft ; for even her very words 
1>ktft cboq deliver to ^ne on the mart. 

S. Drp. I neypr Jfpoke with her in all my life. 

Ant. How-cao m. thus then call us by our names^ 
Unlefe k beby infpirationf 

Adr. How ill agrees it with your gravity^ 
To counterfeit thus grofly with your flave. 
Abetting him to thwart me in my mood ? 
Sc ft my wrong, ^ you are from me exempt. 
But wrong not that wrong with a qiore contempt. 
Come, I will fallen on this flee ve of thine ; 
^' Thou art an ekn^ my husband, I a vine : 
*' Whole weaknefs, marry'd to thy ftronger (fate, 
<^ Makes me with thy (Irength to communicate i 
*^ If aught poOfrb cbee irom me, it is drofs, 

4 ^m^ym art from mt exempt,] Extmftf -fat cfbaoged« 

0^2 n Ufurp- 



228 The Comedy of Ekkoks. 

*' Ufurping ivy, brier, or idle mois ; 

*^ Who, all for wane of pruning, with intrufion 

*^ InfeA thy (ap, and live on thy confufion. 

Jnt. To me (he fpeaks i flie moves me for her 
theam ; 
What, was I marry*d to her in my dream i 
Or deep I now, and think I hear all this ? 
What error drives our eyes and ears amifs f 
Until I know this fure uncertainty, 
I'll entertain the favoured fallacy. 

Luc. Dromio^ go bid the fervants fpread for dinner. 

S. Dro. Oh, for my beads! I ciois me for a finner. 
This is the Fairy land : oh, fpight of fpights ! 
* We talk with goblins, owls, and el vim iprights; 
If we obey them not, this will enfue. 
They'll fuck our breath, and pinch us black and bloc 

Imc. Why prat'ft thou to thy felf, and anfwer'ft 
not ? 
DromiOf thou drone, thou fnail, thou Aug, thou fot I 

5 ir# talk with goblins^ owls, and tMfi J^tghti i\ Here Mr. 
nethald calls out in the namt •fNw/en/i^ the firft time he hidyftr- 
«itf/iy invoked her, to tell him how Otvhc9uUfuck tinir brimtb^ mmd 
finch thim Hack and blue. He, therefore, alters Ow!s to Omfhs^ 
and dans fi^f that his readers nvill aequiefce in thejnftnefs ^hit 
inundation. But, for all this, we muft not part with the old read- 
ing. He did not know it to be an old popular fuperftition» that 
the fcretch^wl fucked out the breath and blood of infants in the 
cradle. On this account, the Italians called Witches, who wot 
(bppoied to be in like manner mifchievoofly bent againft children, 
Strega from Strix, the Scretch-ewl. This fuperflition they had derived 
from their Pagan ancefton, as appears from this paflage oiOvid, 

Sunt avid^ 'volucres \ non qute Phineia menfii 
Guttata frauiahant : (ed genus inde trahunt. 

Grande caput : ftuntes ecnli : roftra afta rapine : 
Canities pennis^ unguihus hamus inefi, 

NoSie 'volant, PUEROSQUB PETUNT nutricis ^entu i 

' Et *vitiant CUN I s carper a rapta/uis, 

Carpere dicuntur laSantia w/cera refiris \ 
. Et plenum poco fanguine gnttnr haheni* 

Efi-Ulis ftrigibus mm#v;— « Lib. 6. Fcft. 



The Comedy of Ekkoks^ :^q 

S. Dro. I am transformed, mafter, am not I ? 

jfnt. I think, thou arc in mind, and fo am I. 

S. Dro, Nay, mafter, bocb in mind and in my 
ihape. 

jfnl. Thou haft thine own form, 

S. Dro. No -, I am an ape. 

Luc. If thou an chane'd co aught, 'tis to an afs. 

S. Dro. 'Tis true j The rides me, and I long for 
grafs. 
'Tis lb, I am an afs ; elie it couid never be. 
But I fhould know her, as well as fhe knows me. 

Mr. Come, come, no longer will I be a fool, 
To put the finger in the Eye and weep^ 
Whilft man and mafter laugh my woes to (corn. 
Come, Sir, to dinner ; Dromio^ keep the gatei 
Husband, Til dine above wich you to day. 
And (hrlve you of a choufand idle pranks ; 
Sirrah, if any ask you for your mafter. 
Say, he dines forth, and let no creature enter : 
Come, fifterj Dromioj j^lay the porter well. 

jlnl. Am 1 in earth, in heaven, or in hell? 
Sleeping or waking, mad or well advisM i 
Known unto thcfe, and to myfclf difguis'd ? 
I'll fay as they fay, and perfcver fo j 
And in this mift at all adventures go. 

S. Dro. Mafter, (hall I be porter at the gate ? j 

jiJr. Ay, let none enter, left I break your pate, i 

Luc. Come, come, Antipbolis^ we dine too late. 3 

[Exiuni. 



0^3 ACT 



tS^ Thf Comdy of lS;KK^Ki, 

ACT III. SCENE I. 

The Street before AntiphollsV Hottfe, 



rv 



Enter Antipholis of Ephefii^ Dr6mio of £pfaefijs» 

Angelo» and Balthazar. 

£• Antipholis. 

GOOD Sfgnior Angela^ you mufl: etctlle us ; 
My wife is Ihrewifk, ti^hen I keep not hours ; 
Say, that I lingtfr'd with you it your (hop 
To fee the making of her carkaMt % 
And that to morrow you will bring it home. 
But here's a villain, tnat would face me dowii 
He met me on the mart, atid that I beat him ; 
And charg'd him with a thouland fnarks in gold > 
And that I did deny my wife and houfe : 
Thou drunkard, thou, What didft thoU ctiean by this ? 
E. Dro. Say, what you will. Sir i but 1 know what 
I know ; 
That you beat me at the mart, I have ydur hand to 

fhow ; 
If the skin were parchment, and the bl0W3 you gave 

were inK, 
Tour own hand-wridng would tell you What 1 think. 
E ylnt. I think, thou art an afs. 
E. t)ro. Marry, fo It doth appear 
dy the wrongs I fuffer, and the blows I bear ; 
I (hould kick, being kickt ; and, being at that pafs. 
You would keep from my heels, and beware ofanafs. 
E. Ant. Y'are fad, Signior Balthazar. Pray God, 
our cheer 
May anfwer my good will, and your good welcome 
here. 
BaL I hold your dainties cheap, Sir^ and your wel- 
come dear. 

E.Anl. 



The Comedy cf Errors. 231 

E. Jta. Ab» Si^ior Raltbazar^ eiiher at flefli or gfb» 
A cable-full of welcome makes fcarce one dainty di(h. 
^Wl Good meaty Sir, iacommoo ^ ch^t every chufl 
affords. 

JB* 4ti. And welcomq niore comcnQQ ; for that*s 
nothing but w<>rds* 

Bal. Small cheer, and g;reat welcome, makes a 
merry fcaft. 

E. jtn$. Ay, to a ni^ardly boft, and nporc fpring 
gucft: 
But tho* my cates be mean, take cheep in good part ; 
Better cheer may you have, but npt with better heart. 
But, ibft \ my door i$ lockt ; ^o bid ihem let us in. 
jE- Dro.Maud^ BriSfetj Manan^ OV^^, Cri//i>«, Qinn ! 
S. Dro. \%mtlm\ Mome, malt-»horft, capon, cox- 
comb, idiot, patch ! 
Either get thee from the door, or (it down at the hatch : 
Doft tHou conjure for wenches, that thpu call'ft for 

fuch ftore. 
When one is one too many ? go, get thee frpm the 
door. 
jj. Htq. What patch is made qw porter ? ipy mailer 

ftays in the ftreet. 
S* Dro. Let him walk from whence he came, left he 

catdi cold on*$ feet. 
£. Ant. Who talks wi(hin there ? hoa, open the 

door. 
S. Dro. Right, Sir, Pll tell you when, an youMI tell 

me wherefore. 
E. Mt. Wherefote ? for my dinner : I have not 

din*d to day. 
S. Dro. Nor to day here you muft not : come again, 

when you may. 
£. AnU What art thou, that keep'ft me out from 

the houfe I owe ? 
S. Dro. The porter for this time^ Slr^ and my name 
is Dronno. 

0^4 £. Dro. 



232 The Comedy of Ekkoks. 

E.Dro. O villian, thou haft floll'n both mine office 

and my name : 
The one ne'er got me credit, the other mickle blame. 
If thou had*ft been Dromio to day in my place. 
Thou would'ft have changed thy face for a name^ or 

thy name for an afs* 
ZjUcc. [within] What a coile is there, Dromio f who 

are thofe at the gate ? 
£. Dro. Let my matter in. Luce. 
Luce. Faith, no -, he comes too late ; 
And fo tell your matter. 

£. Dro. O lord, I mutt laugh ; 
Have at you with ^ Proverb. — Shall I fct in my ftaff? 
Luce. Have at yoq with another \ that's when^ can 

you tell ? 
S.Dro. Ifthynamebecaird Lii^^ Luce^ thou haft 

anfwer'd him well. 
E. 4nt. Do you hear, you minion, youll let us in, 

I trow? 
Luce. I thought to have askt you. 
S. Dro. And you faid, no. 
JE. Dro. So, come, help, well ftruck \ there was 

blow for blow. 
E. Ant. Thou baggage, let me in. 
Luce. Can you tell for whofe fake ? 
£. Dro. Matter, knock the door hard. 
Luce. Let him knock, 'till it ake. 
E. Ant. You'll cry for this, minion, if I beat the 

door down. 
Luce. \Yhat needs all that, and a pair of flocks hi 

the town ? 
Adr. [within] Who is that at the door, that keeps 

all this noiie ? 
S. Dro. By my troth, your town is troubled with 

unruly boys. 
J?, Ant. Arc you there, wife ? you might have come 

before. 

Adr. 



The Comedy of Errors; 233 

Mr* Yoar wife. Sir knave ! go, get you from the 

door. 
E. Dro. If you went in pain, mafter, this knave 

would go (ore. 
jing. Here is neither cheer, Sir, nor welcome ; we 

would fain have either. 
BaL In debating which was beft, ' we flull have 

part with neither. 
£. I>rQ. They ftand at the door, mafter; bid them 

welcome hither. 
E* Ant. There's fomething in the wind, that we can- 
not get in. 
£. Dro^ You would fay fo, mafter, if your garments 

were thin. 
Your cake here is warm within : you ftand here in the 

cold : 
It would make a man mad as a buck to be fo bought 

and fold. 
E. Ant. Go fetch me fomething, ril break ope the 

gate. 
S. Dro. Break any thing here, and PU break yoof 

knave's pate. 
E. Dro. A man may break a word with you. Sir, 

and words are but wind ; 
Ay> &nd break it in your face, fo he break it not 

behind. 
S. Dro. It feems, thou wanteft breaking ; out upon 

thee, hind ! 
E. Dro. Here's too much, out upon tbee ! I pray 

thee, let me in. 
S. Dro. Ay, when fowls have no feathers, and fi(h 

have no fin. 
E. Ant. Well, 1*11 break in ; go borrow me a crow. 
E. Dro. A crow without feather, mafter, mean you 

fo? 

I — ^ mnjhallfart vtiitb miiibir,'] Comnum fcnfe requires us to 
ToA, — — nuifiaU have fart wti ntitbir. 

For 



234 ^ Cmtify cf EZKOK 9. 

For a fiib without a fiQ> there's a fowl without a fea- 
ther: 
If a crow help us io, lirrah, we'll pluck a crow toge- 
ther. 

R Jnt. Go, gpt thee gone»' fetch me an iron crow. 

Bal. Have patience. Sir : ob, let it not be fo. 
Herein you war agamft your reputation. 
And draw within the compafs of fufpcA 
Th' unviolated honour ot your wife. 
Once, this ; — your long experience of her wifdbm. 
Her fober virtue, vears, and oiodefty. 
Plead on her part fome caufe to you unknown ; 
And doubt not. Sir, but ihe will well excufe, 
Why at this time the doors are barr'd againft you. 
Be rul'd by me, depart in patience, 
And let us to the Tyger all to dinner ; 
And about evening come your felf alone. 
To know the reafon of this ftrange reftrainL 
If by ftrong hand you offer to break in. 
Now in the ftirring pafTage of the day, 
A vulgar comment will be made of it ; 
And that fuppofed by the common rout, 
Againft your yet ungalled eftimation. 
That may with foul intrufion enter in. 
And dwell upon your grave when you are dead : 
For flander lives upon mccelfion ; 
For ever hous*d, where it once gets pofleflion. 

E. Ant. You have prevailed \ 1 wul depart in quiet, 
^ And, in defpight or mirth, mean to be merry. 
I know a wench of excellent difcourje. 
Pretty and witty, wild, and, yet too, gentle ; 

2 Jnd. in dij^ight §f mirtb^ ] Mr. TbHimU doti not know 

what to make of this ; and, therefore, has put wrath inflead of 
mirtj^ into the text, in which he is followed by the 0;K/&r^ Edi- 
tor, fint the old reading is right i and the meanisg is, I will be 
merry, even out of fpite to miith, whieh is^ now* of all thingSi 
the moft uopleafing to ae. 

There 



TheCtmedy «fEwitiO%s, 235 

There will we dine : this wdman that I meatis 
lAy wife (but^ I proceft» without defeit,) 
Piath ofcencimes upbraided me wkhal ; 
To her will we to dimier* Get you home» 
And fetch die diain % fay thb^ I know^ 'tis nude i 
Sring it^ I pmy yoo^ to the Pur^ufdne ; 
For there's the boofe : that chaiit will I beftoW» 
(Be it for nothing bat to fpight tnj wife,) 
Upon micie boftds there« Good Sir^ make hafte : 
Since my own doors rtfafe to entertain me, 
rii knock elfewhcre, to fee if they'll difdain me. 

jfyg. ril meet you at that pfalce, foroe hour^ Slr^ 
hence. 

E. Ant. Do {o I this jeft ihstU ooftme ibmeexpence. 

[Exeunt. 

SCENE IL 
I'be Ihufe of AntiphoUs of Ephefus. 

Enter Luciana, with Antipholis of Syracufe. 

Lmc^ and may it be that yoa have quite forgot 

Dl a husband's office ? fhall, JntipboliSy 
Ev'n in the fpring of love, thy love fprings rot ? 
Shall lovi^ in ' building, grow fo ruinate f 
If you did wed my fifter for her wealth. 

Then for her wealth's iake ufe her with more kmd- 
nefs) 
Or if you like elfewhett, do it by ftealth ; 

Muffle your iaife love wkh fome (hew of blindaeis % 
Let not my fifter read k in your eye ; 

Be not thy tongue thy own fliame's orator ; 
Lcwk fweet, fpeak fair % become difloyalty : 

Apparel vice, like virtue's harbinger ^ 

i — jjKi///ijl^/^«.-.] Mn Jiioiald has here remoyed a fopor* 
Amis letter. 

Bear 



236 1^^ Comedy if Errors. 

Bear a fair prefence, tho* your heart be tainted : 

Teach fin the carriage of a holy faint ; 
Be fecret-falfe : what need (he be acquainted'? 

What fimple thief brags of his own attaint? 
'Tis double wrong, to truant with your bed. 

And let her read it in thy iooks at board : 
Shame hath a baftard fame, well managed ; 

HI deeds are doubled with an evil word : 
Alas, poor women ! make us (a) but believe^ 

Being compaft of credit, that you love us ; 
Tho* others have the arm, (hew us the (leeve : 

We in your motion turn, and you may move us. 
Then, gentle brother, get you in again $ 

Comfort my (ifter, chear her, call her wife ; 
'Tis holy fport to be a little vain. 

When the fwcct breath of flattery conquers ftrife. 

S, Ant. Sweet miftrefs, (what your name is elfe, I 
know not 5 

Nor by what wonder you do hit of mine :) 
Lefs in your knowledge and your grace you (how not 

Than our carth*s wonder, more than earth divine. 
Teach me, dear creature, how to think and fpeak } 

Lay open to my earthy grofs conceit. 
Smothered in errors, feeble, (hallow, weak. 

The foulded meaning of your words* deceit ; 
Again(t my foul's pure truth why labour you. 

To make ic wander in an unknown fidd ? 
Are you a God ? would you create me new ? 

Transform me then, and to your pow'r I'll yield. 
But if that I am I, then, well I know. 

Your weeping fifter is no wife of mine ; 
Nor to her bed no homage do I owe \ 

Far more, far more, to you do I decline. 



[ ta) tut. Mr. Theobald Vulg. w/.] 



A 



Oh, 



Tie Comedy of Er ror si 237 

Oh, train me not, fweet mermaid, with thy note» 

To drown me in thy fitter's flood of tears ; 
Sing, Siren^ for tiwfelf, and I will dote ; 

Spread o'er the filver waves thy golden hairs. 
And as a bed PU take thee, and there lye : 

And ^ in that glorious fuppofition think. 
He g^ns by death) that hath fuch means to die ; 

Let love, bebg light, be drowned if Ihe fink. 

Jau. Wfaat^ areTyou mad, that you do reafon lb i 

S. jint. Not mad, but mated ; how, I do. not know. 

Imc. It is a fauk that fpringeth from your eye. 

S. Ant. For g^ing on your beams, &ir fun, be- 
ing by. 

Imc. Gaze where you Ihould, and that will clear 
your fight. 

S. Ant. As good to wink, fweet love, as look on 
night. 

Imc. Why call you me, love P call my fitter fo. 

S. Ant. Thy fitter's fitter. 

Imc. That's my fitter. 

S. Ant. No ; 
It is thyfelf, mine own felPs better part : 
Mine eye's clear eye, my dear heart's dearer heart. 
My food, my fortune, and my fweet hope's aim. 
My fble earth's heaven, and my heaven's claim. 

Imc. ah this my fitter is, or elfe fiiould be. 

S. Ant. Call thyfelf fitter, fweet; for I mean thee : 
Thee will I love, and wkh thee lead my life ; 
Thou hatt no husband yet, nor I no wife. 
Give me thy hand. 

Luc. Oh, foft. Sir, hold you ftill \ 
ril fetch my fitter, to get her good will. 

, [£^V Luciana. 

4 -— — /«/^^f//ar;0«r/fnppofition— — >] rtf/^/ira^ for the thing 
lain open. 

SCENE 



^^S tie Comedy tf E&ao&s; 

SCENE HI. 

5. Ant. Why, how now, Dmm^ where run^ft cfaou 
fo faft ? 

iS*. Dr^. Do 3pou know met Sir ? am I Z3)rMtt9 / am 
I your man ? am I inyielf<? 

f . ^11^. ThoQ art Drami^f tbaa art ^ ]r nan, thou 
aittbyfel£ 

S. Dro. lamanafst I amavomaA^soian, and he- 
fides royielf. 

S, Ant. What woman's man ? and 4iov befides thy- 
fcJf? 

S. Dro. Marry, Sir, befides myfelf, I inm due to a 
woman ; ooe that-daims me, one that haunts lae, one 
that will have me. 

S. Ant. What clabn Jays Aie to lihee,? 

S. Dro. Marry, Sir, fuch a daim a^ you would Jay 
to your horie \ and fhe would have me as a beaft : not 
that, I being a beaft, (he would have me ; but chat 
fhe, being a very bei^y creature, kys claim to me. 

S. Ant. Whatisihe? 

S. Dro. A very reverent body \ ay, foch a one asa 
man naay not fpeak of, without he fay. Sir revewnoe : 
I have but lean luck in the match \ and yet is ihe a 
:wond*rous fat marriage. 

S. Ant. How doft thou mean, a iat marriage ? 

S. Dro. Marry, Sir, ifae's the kicchen*wench, and 
all greafe ; and I know not what ufe to put her to, but 
to make a lamp of her, and run from her by her^wn 
light. I warrant, her rags, and the tallow in them, 
will burn ^ a Lapland winter : if (he lives 'till doomf- 
day, (he'll burn a week longer than the whole world. 

S. Ant. What complexion is (he of ? 

S. Dro. Swart, like my (hoe, but her face nothing 

5 M Poland wntir:"] Folio readi a Lapland winttr. Right. 

like 



Tie Conuiy df £ltlioiis« 239 

like ibdean kt^ ; for lAiy} flic fweats, a man vmj 
go orer ihoes in ^e grime of it. 

S. AHi. That^s a fkalt, that water will mend. 

S. Dro. No, Sir, *tis in grain ; JVmS^s flood could 
oM do It. 

S. Ant. What's Tier name P 

S. Dro. Nett^ Sir ; — bat f j) her name and three 
quarters (that is, an ell and three tjuarters) will not 
meafupe her from hip to lap. 

S. Ant. Then flie bears ibme'bfeadth ? 

S. Dro. No longer from head to foot, than from 
hip to hip : Ihe is fpherical, like a gk>be : i could 
find out countries in her. 

S. Ant. In what part <yf her body Hands Ireland f 

S. Dro. Mamjj Sir, in her buttocks ; I found it 
out by the bogs. 

S. AjU. Where Scotland? 

S. Dro. I found it out by the barrennels^ bu'd in the 
palm of her hand. 

S. Ant. Where France ? 

S. Dro. In her forehead ; arm'd and reverted, ma« 
king war • againft her heir. ■ » 

S.Ant. Where England ? 

S. Dro. IlookM for the chalky clifis, but I could 
findnowhitenefs in them ; but Iguefs, it ftood in her 
chin, by the fait rheum that ran bet ween ir^urr and it. 

S.Ant. VThcTt Spain? 

S. Dro. Faith, I iaw it not, but I ieh it hot in her 
bfeath. 

S. Ant. Where America^ the Indies ? 

S. Dro. Oh, Sir, upon her nofe, all o'er embellifh'd 
with rabies, carbuncles, faphtres ; declining their rich 
aipeAtothe hot breath of «9^Am, who fent whole arma^ 
does of carradts to be ballaft at her nofe. 

6 ^MH/t her hgir. ] Heit. IV. x>f FrartH. At tliat that the 

Lctgoe WAS in arms^gainit him. 

X '^*) •*" ^'^ ^^^^ *»'# l^^' Thirlby-— - Vulg. ber name it ] 

S. Ant. 



a40 "Ihe Comedy dfEKKOKS. 

S. Ant. Where ftood Belgia^ the Netherlands? 

S. Dro. Oh, Sir, I did not look fo low. ^ To con- 
clude, this drudge of the devil, this diviner, laid 
ddim to me, call'd me Dromoj fwore I was aflur'd 
to her, told me what privy marks I had about me, as 
the marks of my fhoulder, the mole in my neck, the 
great wart on my left arm, that I, amaz'd, ran from 
her as a witch. * And, I think, it my bread had not 
been made of faith, and my. heart of ftee), Ihe had 
transformed me to a curtal*ddg, and made me turn 
i'th* wheel. 

S. Ant. Goj hie thee prefently \ poft to the road ( 
And if the wind blow any way from fhore, 
I will not harbour in this town to night. 
It any bark put forth, come to the mart ; 
Where I will walk, 'till you return to me : 
If every one know us, and we know none, 
'Tis ixttft^ I'think, to trudge, pack and be gone. 

i9. Dro. As from a bear a man would run for life, 
So fly 1 from her that would be my wife. [£x{/. 

SCENE IV. 

S. Ant. There's none but witches do inhabit here j 
And therefore 'tis high time that I were hence: 
She, that doth call me husband, even my foul 
Doth for a wife abhor. But her fair fitter, 
Fofleft with fuch a gentle fovereign grace, 

7 TeconcluJi, this drudgt^ 9rdi'uintr^ laid claim to mi ^ A lit- 
tle lower, he calls her nvttcb, A word is certaialy dropt out of 
the text. We fhould read» 

this drudge ov the devil, this diviner^ 
Drudge of the Devils is the right pariphrafis for a switch. 

8 ^nd, I thiifitt if my ireaft had not been made ^/^ faith, &( 1 
Allading to the fuperflition of the common people, that noihing 
could refift a witch's power, of transforming men into animals, 
but a great (hare of faith : however the Oxford Editor thinks 
<g hreaji made of flinty better iecurit^, and haa therefore put it io. 

Of 



The Comedy of Errors. 241 

Of fuch enchanting prefence and difcourfc. 
Hath almdl made oie traitor to myfelf: 
But left my felf be guilty of felf- wrong, 
I'll ftop mine ears ag^inU the mermaid's long. 

Enter Angelo, with a chain. 

. Jint. Mafter AntiphoUsy *— - 

S. Am. Ay, that's my name. 

Af^. I know it well. Sir ; lo, here i$ the chain 1 
I thought to have ta^en you at the Porcupine % 
The chab, unfini(h*d, made me (lay thus long. 

S. Ant. What is your will, that I fhail do with this? 

Ang. What pleafe yourfclf. Sir \ I have made ic 
for you. 

S. Ant. Made it for me. Sir! 1 befpoke it not. 

Ang. Not once, nor twice, but twenty times, yoo 
have: 
Go home with it, and plcafe your wife withal \ 
And ibon at fupper-time Til vilit you. 
And then receive my mony for the chain* 

S. Ant. I pray you. Sir, receive the mony now \ 
For fear you ne^er ice chain, nor mony, more. 

Ang. You are a merry man, Sir^ fare yoo well. 

{ExU. 

S. Ant. What I fhouid think of this, I cannot tell : 
But this I think, there's no man is fo vain^ 
That would refule fo fair an ofier'd chain« 
1 lee, a man here needs not live by (hitcs. 
When in the ftreers, he meets fuch golden gifts : 
I'll to the mart, and there tor Drondo (lay ^ 
if any (hip put our, then ftraight away. {Exit. 



Vol. in. R ACT 



242 ^ Cmt^ •f EaaoRf. 

ACT IV. SCENE L 

The SrREBt, 
Enter s Mercbantf Angelo, atid an Officer. 

Mbrchaht. 

YO U know, fince Pentecoft the fum is doe ; 
And fince I have not much ioipoitun'd you^ 
Nor now I had not, but that I am bound 
To Perjta^ and want gilders for my voya^ : 
Therefore make prefent fatisfaftion ; 
Or Pll attach you by this officer. 

Altg. Ev'n juft the fum, that I do owe to yoUf 
Is growing to me by AntipboRs ; 
And, in the inftant that I mtx. with you. 
He had of me a chain : at five o* cIock9 
1 (hall receive the mony for the fame : 
Pleafe you but walk with me down to his hou(^» 
I will difcharge my bond, and thank you too. 

EnUt Amipholis af Ephdus, and Dromio ^^pkefusi 

asfr(m the Courtezan* s. 

Offi. That labour you may lave : fee, where k 

comes. 
£. jint. While I go to the goldfrnith's boufe, go thou 
And buy a rope's end ; that will I beftow 
Among my wife and her confederates. 
For locking me out of my doors by day. 
But, foft ; I fee the goldfmith : get chee gone. 
Buy thou a rope, and bring it home to me. 

E. Dro. I buy a thouland pound a year I I baj a 
rope ! [^Erit Dromia 

E. Ant. A man is well holp up, that trufts to you : 
I promiied your prefence, and the chain : 

But 



Th Cme4jt^ ^KVi^QKh 243 

Bplike, you thought, our love would )^(V too long 
1£ it were cha^i'd tos^^^ ; thcrtkyrp came not. 

^4!^. Saving your merry humour^ here's the note^ 
How much your chain weighs to the utmoft carrat 1 
The finenefs of the gold, the changeful iaibion % 
Which do amount to three odd ducat) qnore^ 
TbaA I ftajnd debted to this gentleman ; 
I pray you, (ee him pfefently difchargM i 
Fpr be i$ bound to f(»» and (|ay$ bu( for it. 

E. An$, I am not fgirnifli'd with the prefexK niony } 
Befides, I have fome bufinefs in the town ; 
Good Sgnior, takt th? dmog^r to my ho^fe. 
And with you take the chain^ and bid my wife 
Disburie the fijm on the roceicc ther,eol' i 
Perchance, I will be there as iboji as you. 

Ang. Then you will bring the chain to her yourfelf ? 

E. jlnt. No ; bear it with you, left I CQifie not time 
enough. 

Ang. Well, Sir, I wiU : have you tine chain a^Que 

fOtt? 

E. jviu An if I haM npCt Sir, I hcf)e, you have: 
Or elfe you may return without your mony. 

Ang. Nay, conne, I pray you, Sir, gjve nie the chaifi i 
Both wind and tide ftay for this gentiemaii ; 
And I, to blame, have held him hei:e too Ipng. 

E. Anf. Good lord, yoy uie this dalliance to ccufe 
Tour breach of promife to the Porcupint : 
I Ihould have chid yau for not brio^ng it ; 
But, like a (brew, you ^rft begin to brawL 

Mer. The hour fteals on ; I pray you. Sir, difpaleh. 

Ang. You hear, how he importunes me ; the chain«-« 

£. Ant. Why, givt k to my wjfe, gtid fetch your 
mony. 

Af^. Oune, com«» yp« koow, I gi^rs it you, 
cv*n nov. 

Or fend the chain, 9x fend me Iby &>metokeq. 

R z E.Ant. 



244 The Comedy of Ekkoks. 

E. Ant. Fie, now you run this humour out of 
breath : 
Come, Where's the chain ? I pray youj let me fee it. 

Mer. My bufinefs cannot brook this dalliance: 
Good Sir, lay, whe'r youMl anfwer me, or no| 
If not. III leave him to the officer. 

E. Ant. I anfwer you? why Ihould I anfwer you? 

Ang. The mony, that you owe me for the chain. 

£. Ant. 1 owe you none, 'till I receive the chain. 

Ang. You know, i gave it you half an hour fincc, 

£. Ant. You gave me none ; you wrong me much 
to fay fo. 

Ang, You wrong me more. Sir, in denying it; 
Confider how it ftands upon my credit. 

Mer. Well, officer, arreft him at my fuit. 

Offi. I do, and charge you in the Duke's name to 
obey me. 

Ang. This touches me in reputation. 
Either confent to pay the fum for me. 
Or I attach you by this officer. 

E. Ant. Confent to pay for that I never had ! 
Arreft me, foolifli fellow, if thou dar'ft. 

Ang. Here is thy fee ; arreft him, officer 5 
I would not fpare my brother in this cafe. 
If he (hould icorn me fo apparently. 

Ojji, I do arreft you. Sir \ you hear the fait. 

£. Ant. I do obey thee, 'till I give thee \m\. 
But, Sirrah, you fhall buy this fport as dear 
As all the metal in your (hop will anlwer. 

Ang. Sir, Sir, I ftiall have taw in Epbefus^ 
To your notorious fliame, I doubt it not. 

SCENE II. 

EfUer Dromio of Syfacufe, from the Bay. 

5. Dro. Matter, there is a bark of Epidamnumt 

That ftays but till her owner comes aboard ; 

Then, 



7%e Comedy ^ £ R R o r s.^ 245 

Then, Sir, flic bears away. Oik" fraughcage, Sir, 
I have convey'd aboard i and I have boughc 
The Oy/, the Balfamum^ and Aqua-vita. 
The (hip is in her trim ; the nnerry wind 
Blows niir from land % they ftay for nought at all. 
But for their owner, mafter, and yourfelf. 

E. Ant. How now ! a mad man ! why, thou peevifh 
flieep. 
What (hip of EpiJamffum (lays for me ? 

S. Dro. A (hip you fent me ro, to hire waftage. 

E. Ant. Thou drunken (lave, I fent thee for a rope^ 
And told thee to what purpo(e, and what end. 

S. Dro. You fent me for a rope's-end as (bon : 
You (ent me to the bay. Sir, for a bark. 

£. Ant. I will debate this matter at more leifure. 
And teach your ears to lift me with more heed. 
To Adrianaj villain, hie thee ftraight. 
Give her this key, and tell her, in the desk 
That's covered o'er with Turkijb tapeftry. 
There is a pur(e of ducats, let her fend it : 
Tell her, I am arretted in the-ftrett. 
And that (hall bail me ; hie thee, (lave; be gone: 
On, officer, to prifon 'till it come. [Exeunt^ 

S, Dro. To Adriana ! that is where we din'd. 
Where Dowfahel did claim me for her husband ; 
She is too big, I hope, for me to compafs. 
Thither I muft, altho* againft my will. 
For (ervants mud their matters' minds fulfil. {Exit. 

SCENE IIL 

Changes to E. AntiphoUs'i Houfe. 

Enter Adriana and Luciana. 

Adr. A H, Luciana^ did he tempt thee fo ? 

/\ Might'tt thou perceive aufterely in his eye 
That he did plead in earneft, yea or no f 

R 3 Look'd 



24^ The Comedy if Errors. 

LookM hfc er red ot- pale, or &d or merrify f 
Whac obftrration niad^ft thou itt thU caft^ 
Of his heart's ■ mi^t^ors tilting iiH hb face? 

Ltu. Firft he deriy^d, ydu had in him no ri^. 

Mr. rie meant* he did me none, the more my ibight, 

jLuc. Then fwore he» that he was a ftranger hm. 

4dK And true he fwore» lihough yd forfWom he 

were. 
Luc. Then pleaded t for you. 
^dK And what faid he i 

Xmc. That love I beggM for you, he beggM of me. 

^r. With what pcrfualidn did he tempt thy loveP 

Luc, With words, that in an honelt fuit might mote, 
Firft, he did praife my beauty« then my fpeech. 

Mr. Did'ft fpcak him fair? 

Luc. Have patience, 1 befeech, 

Mr. I cannot, nor I will not, hold me ftilU 
My tongue, though not my heart, (hall have its will, 
He is deformed, crooked, old and f^re, 
rU-facM, worfc-bodv'd, ttiabelefi ever^ where; 
Vicious, ungentle, foolifb, blunt, unkind, 
Stigmacical in makbg, worfe in mind. 

Luc. Who would be jealous then of lUdi a One? 
No evil loil is wailM, when it i^ gOne. 

Mr. Ah ! but I think him better than t fay. 
And yet, would herein Others^ eye^ were wofle: 
* Far from her nefi the lapwing cries away ; 

My heart prays for biiin, tho^ tny tongue do curfe. 

1 *— - mHi9rt HJtitig in Us flUiT^ Allodiflg t0 thofe meteors 
in the sky which have the appearance of lines of armies meeting 
In the (hock. To thu a^peastace he ooriipares eivii «»an in am^ 
ther place, 

WbUb^ Uh th mtiori if a inM$i hm^^n, 

Ml 9f Mi natmn of omtjmhftanct hrti^ 
Did taiiif mat in ihi hui/lhiJUci 

s e E N E 



Tie Gmuify of EkkoHs. 247 

S C E N E IV. 

EnSdT Dromio of Syracufe, 

S. Dro. Here, go ; the desk, tfaepurfei iWeet now, 
make hafte. 

Luc. How haft thou loft thy breath f 

S> Dro. By running faft. 

jfdr. Where is thy mafter, Dromio ? is he well ? 

S. Dro. No, he*s in Tartar Limho^ worfe than hell ; 
A devil in an eirerlafting garment hath him. 
One, whofe hard heart is button'd up with Reel : 
A 6end| a (a) fiiry, pitilefs and rough, 
A woif, nay, worfe, a fellow all in buff; 
A back- friend, a (houlder-clapper, one that commands 
The paflages of allies, creeks, and narrow lands ; 
A hound that runs counter, and yet draws dry*foot well i 
One, that, before the judgment, carries poor fouls to 
hell. 

Mr. Why, man, what is the matter? 

S. Dro. I do not know the matter } he is ^refted on 
the cafe. 

jidr. What, is he arrefted ? tell me, at whole fuit. 

S. Dro. I know not at whofe fuit he is arrefted, 
well ; but he's in a fuit of buff, which *refted him, 
chat I can tell. Will you fend him, miftrefs, redemp- 
tion, the mony in his desk ? 

Jidr. Go fetch it, fitter. This I wonder at, 

^Exit Luciana. 
That he, unknown to me, fliould be m debt I 
Tell me, was he arretted on a bond ? 

S. Dro. Not on a bond, but on a ftronger thing, 
A chain, a chain ; do you not hear it ring? 

Adr. What, the chain? 

[(m) — finj. Mr. ThcoUUt — Valg./w^.] 

R 4 S. Dro. 



9^8 TU Comedy of Ekkoks. . 

^. Dro. No» no ; the bell ; 'cis time diat I wera 

gone, 

Jt wa» two ere I left him^ and now the clock firikci 

one. 

Jdr. The hoyrs come back ! that I did never hear. 

S. Dro. Oyes, if any hour meet a lerjeant, a* turns 

back for Tcry fcan 
Adr. As if time were in debt! how fondly doft 

thou reafon ? 
S. Dro. Time is a very bankrout» and owes more 
than hc*s worth, to fcafon. 
Nay, he's a thief too ; have you not heard men fay^ 
That Time comes dealing on by night and day ? 
If Time be in debt and theft, and a ferjeant in the way» 
Hath he not reafon to turn back an hour in a day ? 

^nter Luciana. 

jfdr. Go, Dromio 5 there's the mpny, bear it ftraight, 
And bring thy mafter home immediately. 
Come, fitter^ I am prcft down with conceit ; 

Conceit, my comfort and my injury. [^Exeunu 

SCENE V. 

Changfs to the Street. 

Enter Antipholis of Syracufc. 

S. if«^T** HERE'S not a man I meet, but doth 

L falpte me. 
As if I were their well-acquainted friend ; 
And every one doth call me by my name. 
Some tender mony to me, fome invite me \ 
Some other give me thanks for kindneflcs ^ 
Some offer me commodities to buy. 
Ev'n now a taylor cali'd me in his (hop, 
And (howM me filks that he had bought for me. 

And 



the Comedy of Errors. 249 

Ancl therewithal took meafure of mjr body. 
Sure, thefe are but imaginary wiles, 
And Lapland ibroerers inhabit here. 

Enter Dromio of Syracufe. 

« 

S. Dro. Mailer, here's the gold you fent me for ; 
what, have you got rid of the pi&ure of old Adam 
new-apparel'd ? 

S. 4nt. What gold is this? what Adam doft thou 
mean ? 

S.Dro. Not th^t Adam ^ that kept the paradife; 
but that Adamy that keeps the prifon ; he that goes 
in the calves skin, that was kill'd for the prodigal i 
he that came behind you, Sir, like an evil angel, and 
bid you torfake your liberty. 

S. AfU. I underftand thee not. 

S. Dro. No? why, *tis a plain cafe; he that went 
like a baie-viol in a cafe of leather; the man. Sir, 
that, when gentlemen are tired, gives them a fob, and 
'refts them ; l^e. Sir, that takes pity on decayed men, 
and gives 'em fuits of durance ; * he, that fets up his 

reft 

2 hi 9 that fets up hU reft to do mon exploits ivith his SKoce^ those 
s MOiiRis*/ii(#.]&^// vp his Refit is a phraie taken from military 
exerciie. when gunpowder was firft invented, its force was very 
weak compared to that in prefent ufc. This neceflarily required 
fire-arms to be of an extraordinary length. As the artifb improved 
the ftrength of their powder, the foldiers proportions biy (hortned 
their arms and artillery ; fo that the cannon which Froiffart tells 
us was once fifty foot long, was contraded to leG than ten. i hit 
proportion likewife held in their muskets; fo that, till the middle 
of the laft century, the musketeers always fupported their pieces 
when they gave fire, with a Reft ftuck before them into the ground, 
which thi^ iMtd/ettiss^ up their Reft, and is here alluded to. There 
is another quibbling allufion too to the ierjeant*s office of arrefting. 
Bat what moft wants animadverfion is the morris-fike^ which it 
without meaning, impertinent to the feaie, and falfe in the alia- 
ficm ; no pike Ming nied amongft the dancers (b called, or at leall 
not fiun'd for mach execution. In a word, SheskeJ^ar wrotc» 

es UAVKicuPihe, 
i. #. a Pikeman of Prince Memrice^a army. He was the greateft 

general 



250 The Qomtdy of Errors* 

reft to do more cxfrioks wich Ui mice, dtan % 
Maurice-Pike. 

S. Ant. What! dKMi mean'ft an officer? 

S. Dro. Ay, Sir, the ferjeant of the band % he, that 
brings any nian to anfwer it» that breaks his bond \ 
one that thinks a man always going to bed, and fitich, 
God ^ve you good reft ! 

S. Ant. Well, Sir, there reft in your foolery. 
Is th€r« any Ihip puts fotth to night f may we be 
gone ? 

S. Dro. Why, Sir, I brought you word an hoor 
fince, that the bark Expedition puts forth to night, 
and then were you hindered by the ferjeant, to tarry 
for the hoy Dekrf i here are the angds that you fent 
for, to deliver you. 

S. Ant. The fellow is diftraft, and fo am I, ^ 
And here we wander in illufions ; 
Some birfied power deliver us from hence ! _ 

S C E N E VL 

Enter a CourteTuin. 

Cour. Well met, well met, mafter AntipboUs. 
I fee. Sir, you have found the goldfmith now : 
b that the chain, you promised me to day i 

S. Ant. Satan, avoid! I charge thee, tempt me not. 

S. Dro. Mafter, is this miftrefs Satan ? 

S. Ant. It is the devil. 

S. Dro. Nay, flie is worfe, flie*s the dcviPs dam ; 
and here (he comes in the habit of a light wench, and 
tliereof comes, that the wenches iay^ God. dam me, 

fwral of d^ftt age, asd ds condvAor of the Umyemmfy mm 
agBinft ^mm^ oador whoiB all the Bwgli/h Gentry and Nobilitjr wot 
ftred to the ftrvice. Being^ iMqiieDtly overboni with iiii8ilier% ha 
became frmous for hk ftne RetnNics« in which a ftand of Pikes ii 
of mat fenrice. Hence the Pikes of hk armjr becaj&e fiuaooa bt 
Iheir ailitar/ sxpkits, 

dial's 



that's as much astofty^ Odd make me a light ivench. 
I It is written, tfarjr appoir to umi like an^ls of light ; 
li^ is an efieA offing Md fire will burn ; irgOiixfjsii 
wenchis wiU bom ; coine not near har« 

Cour. Your min and you are marvellous mcrry^Sir* 
Will you go wkh me« wtf 11 coend our diuier here ? 

S. Dro. IA^Sm^ if you do ei^eft fpoooHiiesi, be* 
Ipeak a long fpoon. 

S. Ant. Why, Dfmid f 

S. Dro. Vimt^^ bt muft have a long ipmn, that 
iBUft eat with the devil. 

S. AnL Avoid then, fiend I what tell'ft thou me of 
fttf^xng f 
Thou art, as you are all, a ibrcerefs : 
J conjure thee to leave me, and be gone* 

Cour. Give me the ring of mine, you had at dinner. 
Or for my dbmond the chain you promis*d» 
Abd 1*11 be gone. Sir, and not trouUe you. 
- S. Dro. Some devils ask but the paring of one's 
nail, a rulh| a hair, a drop of bloda, a pin, a nut, 
a cherry-ftone : but Ae, mora covetous, would have 
a chain. Maflser, be wife 1 an if you give it her, tbe 
devil will fhake her chab, and fright us with it. 

Cour. I pray you. Sir, my ring^ or elfe the chain 1 
I bopei you do mot mean to cheat me ib ? [go. 

S. AfiS. Avaunt, thou witch ! come, Dromio^ let us 

S. Dro. Fly pride, lays the peanck ; miftrels, that 
you know. [Exeunt. 

SCENE vn. 

Manet Conrtezan. 

Cottt. Now^ out of doubt, AntipboUs is mad % 
EMe would he never To demean hknfelf. 
A ring he hath of nunc worth forty ducats^ 
Aad for the lame be promisM me a chain ^ 
Bothone, and other^ be denies me now. 

The 



252 Tf^e C(medy of E rrors. 

The reafon, chat I gather, he is mad, 

(Befides this prefenc inftance of his rage) 

Is a mad tale he told today at dinner. 

Of his own door being ihut againft his entrance. 

Belike, his wife, acquainted with his fits. 

On purpofe (hut the doors againft bis way. 

My vfay b now to hie home to his hottte^ 

And tell his wife, that, being lunatick. 

He rufh'd into my houfc, and took perforce 

My ring away. This courfe I fitteft chufe ; 

For forty ducats is too much to lofe. \EvAt. 

SCENE VIIL 

Cl?anges to the Street. 

Enter Antipholis of Ephefus, wiib a Jailor. 

E. Ant, T^ E A R me not, man \ I will not break 

Jl away ; 

I'D give thee, ere I leave thee, fo much mony. 
To warrant thee, as I am 'refted for. 
My wife is in a wayward mood to day^ 
And will not lightly truft the meflenger. 
That I fhould be attached in Epbefus^ 
I tell you, *t would found harihly in her ears.-— 

« 

Enter Dromio ^ Ephefus, with a Rope's-end, 

Here comes my man ; I think, he brings the mony. 
How now. Sir, have you that I fent you for ? 

E. Dro. Here's that, I warrant you, will pay 
them all. 

E. Ant. But where*s tlie mony ? 

jE. Dro. Why, Sir, I gave the mony for the rope. 

E.Ant. Five hundred ducats, villain, for a rope? 

jE. Dro^ V\\ ferve you. Sir, fivehunBred at the rate. 

£. Ant. To what end did I bid thee hie thee home \ 

E. Vn. 



The Comedy of ErrorsJ 253 

£« Dro. To a xope's-end. Sir \ and to chat end am 
I returned. 

E. Ant. And to that end, Sir, t will welcome you. 

[^^^i Dromio. 

Q^. Good Sir, be patient. 

E. Dro. Nay » *tis for me to be patient ; I am m 
adveriicy. 

Offi. Good new, hold thy tongue. 

E. Dro. Nay , rather perfiiade him to hold his 
hands. 

E. Ant. Thou whorlbn, ficnfelels villain ! 

E. Dro. I would, I were fenielefi, Sir, that I might 
not feci your blows. 

E. Ant. Thou art fenfible b nothing but bbws^ and 
fo is an afi. 

E. Dro. I am an afi, indeed ; you may prove it by 
my long cars. I have ferv*d him from the hour of my 
nativity to this inftant, and have nothing at his hands 
for my fervice but blows. When I am cold, he heats 
me with beating \ when I am warm, he cools me with 
beating ; I am wak*d with it, when I fleep ; raised 
with it, when I fit ; driven out of doors with it, when 
I go from home ; welcomed home with it, when I 
return ; nay, I bear it on my ihoulders, as a beggar 
wont her brat ; and, I think, when he hath lam*d 
me, 1 fhall beg with it from door to door. 

SCENE IX. 

Enter Adriana, Luciana, Courtezan^ and Pinch. 

E. Ant. Come, go along \ my wife is coming yon- 
der. 

E. Dro. Miftrels, » refpice finem^ rcfpeftyour end ; 

or 

3 Mifinfs^ refpice finem, rtJ^S y$ur $nd ; tr rtuher tbt fr9' 
fhecie^ &h tbt farr^f, iivfuri th$ ropi$'i9id.'\ Thcfe wolds feem 
IP allude to % amoas pamphlet of that time, wrote l>y Buchanan 

' againft 



954 3!^ Qmtif of Erro&s. 

n>pc*s-cnd.— 

E. Aa. Will thou ftUl tsik \ {Beats Prcynio. 

Qmr. Haw fay you now? is not your husband 
mad ? 

iil^. Hi» iMivUity coafirms no le& 
Good Dodtor Pincb^ you are a Cbnjurer^ 
Eftabliih him in hit true icnfe ^^^lat 
Andl I will ple^fe you what you will demand. 

Luc. Alas, how fiery and how Hiarp he lool($! 

Cour. Mark« how hf tswMm in his cxtafie! 

AVirft. Give im your hMd» m4 lA( me feel your 
pulie. 

5.-A;. Thcw i* my hand, Md I*t it fcol your car. 

Pi»^^. I charge thee, Satan^ hous*d witbintbis mm$ 
To ykld peflUiM to my holy ppaym; 
And to thy fta^ of darknefs hie thee ftcaight, 
I coi^ure thee by all the $4iats in hcav'n. 

K JM. Peaces doatmg wisiard, peaces I amoot 
mad. 

Mr. Qh, that thqu wfft not, pitx^r diftrefled ibi))! 

E. Ant. Yott minion, you, sfcthfTe your cu^nnnn? 
Did this companion with the faffron fa^ 
Revel and fealt in at my houfe to dty, 
Whilft upon me the guilty doors were Ihut, 

agaaoft the Lord of Liiiiiigt§n ; wj^ch ends with theTe woids, 
Keffict fintm^ njpiafimim. BoC to what pnrpofe, nnlefs oar .Au- 
thor would (hew that he coald quibble as well in Bt^lifi^ as the 
other in Latin^ I confefs I know not. Aziattropb^ii^likttk 
pmrp&t^ this aU^daa tft people's uncbiag that hira aalucky words ; 
with which, when any paflenger was offended, it was the fiand- 
ing jeke of the wife owner ta &y, Tmki hetd. Sir, wtf parrwi ff 
pbefies. To this, Buiier hints, where, fpeaking of Rs/fbtit tluli 
ia augary, he fiiy^ 

Cw/J till ivbmt fuhUfl fmrttU miom, 

nut J^ak smd think cmtrary cUim\ 

Whmi m§9iir 'tit tf 'iMm thr^ tttik,. 

mtn thif cry R09B, mitd walk, knave, walk. 

And 



Tie Cemeiy of £ rilors. 255 

AbA I deny*d to enter in my hcwfe i 

Air. Oh, husband, God dodi know, jpois din^d at 
home. 
Where, 'would yoo had reinam\I until this tinae. 
Free from thefe danders and this open fliame ! 
E. Am. Dm^d I at home? tbou iFiHain, what fay^ft 

tfaott? 
E. lyro. Sir, fcoth to fiif , you did not dine at home. 
E. Ant. Were not my doom lockM up^ and I fhut 

out? 
£* Dr0. Peidic, your doors wve locked, and you 

(but out. 
E. Ant. And did not ffae herfelf revile mediere ? 
j^. i)fi0. Bans ftUe, Ihe herfelf revil'd you there. 
E. Ant. Did net her kitchenrmaid rail, euint, and 

fcorn me ? 
E. Dr^. Certes^ (he did, die kitchen-reftal foonk*d 

you. 
JE. Attt. And did I not in rage depart from thence ? 
E» Z>v» Iq verior, you did ; my bones hear witaefs. 
That fince have feit the vigour of your rag|e. 
Air. k't gppd CO foath him in theft contraries ? 
Pincb. It is no fhame ; the fellow feids his vein, 
AxKJ, yieidifig tt> him» humours well his frenzy. 
' E. Ant. Thou haft fuborn'd the goldfoiith to arreft 

me. 
Adr. Alas, I (cnt you mony to ncdeem yoo^ 
By Dromio here, who came in hafte for it. 

E. Dr(^ Mooy by me i heart and good will you 
might. 
But, (intiy, mafter, not a rag of mony. 
E. Ant. Wenc'ft not thou to her for a purfe of du- 
cats? 

ft 

Adr. He came to sie, and I delivered it. 
Luc. And I am wieoefs wkh her, that (he did. 
E- Dn9. God aod therc^-makerdo bear mewitnefs. 
That I was fent for nothing but a rope. 

Pincb. 



■256 ^^ Comedy of ERRdRs. 

Pinch, Miftreis, both man and mafter are po&S; 
I know it by their pale and deadly looks \ 
They muft be bound, and laid in fome dark room. 

E. AfU. Say, wherefore didft thou kxdc me forth to 
day. 
And why doft thou deny the bag of gold ? 

Adr. I did not, gentle husband, lock thee forth. 

£. Dro. And, gentle mailer, I received no gold, 
But I confefs. Sir, that we were lock*d out. 

Adr. Diffcmbling villain, thou Ipeak'fl falfe in bodu 

£. Ant. Diflfembting barloc, thou art falfe in all ; 
And art confederate with a damned pack. 
To make a Joathibmfe abjeA icornor me: 
But with thefe nails I'll pluck out thofe fklle eyesy 
That would behold in me this (hamefol fport. 

Enter three or Jwr^ and offer to hind Um : beftrines. 

Adr. Oh, bind hlm^ bind him, let him not come 
near me. 
: Pinch. More company ;~the fiend is ftrcMig within 
him. 
Luc. Ay me, poor man, how pale and wan he 

looks! 
jE. Ant. What, will you murther me^? thou jailor, 
thou, 
I am thy prifoner, wilt thou Tuffer them 
To make a reicue ? 

O^. Matters ; let him ^o : 
He is my prifoner, and youihall not have him. 
Pinch. Go, bind this' man, for he is frantick too. 
Adr. What wilt thou do, thou pepvifli officer ? 
Haft thou delight to fee a wretched man 
Do outrage and difpleafure to himfelf ? 

Offi. He is my prifoner ; if I let him go. 
The debt, he owes, will be required of me. 

Adr. I will difcharge thee, ere I go from thee \ 

Bear 



iis CcMie^ of EnJkOK 94 2§y 

Sear me forthwith unto his creditor, 

[Tbey Innd Antipholis and Dromia. 

And, knowing how the debt grows, I will pay ir: 

Goodmaflef Dodtor^ feehmi fafe corrvey*d 

Home to my houfe. Ob, rood Unhappy day ! 
E. Ant. Oh, moft unhappy ftrumpet I 
JB. Tiro. Nlaftef, Tm hcfe cntcr'd in bond for you^ 
E. Ant. Out on thee, Villain ! whcitforc doft thou 

mad me ? 
i&. J^ro. Will you be bound for hbtiiing? be ffiad^ 

good mafter ; cry, die devil.—— 

Luc. God help, .poor fouls, how idly do they talk ! 

Air. Go bear him hence i fiftef, ftay you wi thine. 

[;Exeunt Pinch, Antipholn, and I>omia. 

Say now, whofe fuit is he arrefted at? 

SCENE X. 

Manent Officer^ Adriana^ Luciana^ and CoUrte:taH. 

Offi. OntAngilo^ agoldfmith ; do you know him. ^ 

Adr. I know the man ^ what i^tbe fum he owes ? 

Offi. Two hundred ducats. 

Adr. Say, how grows it due ? 

Ojfi. Due for a chain, your husband had of him. 

Adr. He did befpeak a chain for me, but had it not. 

Cour. When as your husband afl in rage to day 
€ame to my houfe, and took away my ring, 
(The ring I law upon his finger now) 
Straight after, did I Aneet him ttrith a chatri. 

Adr. It may be fo, but I did never fee it. 
Come, jailor, being me where the goldfmith is^ 
I long €o know the truth hereof at Targe. 



Vol. hi. S S CENE 



258 The Cmeij of Ekhoks. 

SCENE XL 

Enter Antipholis 0/ Syracufe, ^h bis Rapier dremM^ 

and Drcmiio rf Syncufe. 

Lne. Godf for thy mercy^ they are looie again. 
jfdr. And come with naked fwords ; 
Let's call more help to have than bound again. 
Offi. Away, they'll kill U0. [Thy nm oni. 

Maneni Antipholis and Dromio. 

S. Ant. I fee, theft witches are afraid of fwordt. 
S. Dn. She, that would be your wife, now ran from 

you. 
S. Ant. Come to the Centaur^ letch our fluff from 
thence : 
I long, that we were iafe and (bund aboard* 

S. Dro. Faith, flay here this night 4 tixcj will fiircly 
dd us no harm ; you faw^ they (pake ua uir, gave iu 

Kid *, methinks, they are fuch a ginitle nation, that 
t for the moundkrn of mad flefh that claims marriage 
of me, I could find in fnj heart to flay here fiill, and 
turn witch. . 

S. Ant. I will not flay to m^ ior all the town ; 
Therefore away, to get our fluff abcxoxL lExennt. 



t '" 



ACT V. S C EN E I. 

A Street^ iejfpre^ a Priory^ 
Enter the Merchant aiui Angdo» 

A N O B L O. 

I A M forry. Sir, that I have hmder'd you i 
But, L proteft, he had the chain of OKw 
Tho' mofl dilhoneftly he doth deny it. 

Mir. 



r 



TieCmeJy of £rrors. 259 

Mer. How is che man efteeni*d here in (he city ? 

Jng. Of very reverent reputation, Sir^ 
Of credit infinite, highly bdov*d, 
Second to none that Jives here in the city } 
Hb word might bear my wealth at any time. 

MeK Speak foftly : yonder, as I think, he walk$* 

Enier Antipholis and Dromio (f Syracufe^ 

Ang. ^Tis (b ; and that felf-chain about his neck^ 
Which he forfwore moft monftroufly to have. 
Good Sir, draw near to me, I'll fpeak to him. 
Signior Antipholis^ I wonder much 
That you would put me to this flume and trouble } 
And not without Ibme fcandal to yourlelf, 
With circumftancc and oaths fo to deny 
This chain, which now you wear fo openly 5 
fefidcs the charge, the (hame, imprifonment. 
You have done wrong to this my noneft friend i 
Who, but for (laying on our controverfie^ 
Had hotfted fail, and put to lea to day : 
This chain you had or me, can you deny it ? 

S* Ant. I think, I h:id 4 1 never did deny it. 

Mer, Yes, that you did. Sir ) and forfwore it too. 

S Ant. Who heard me to deny it^ or forfwcar it ? 

Mer, Thele cars of mincj thou knoweft, did heai; 
thee ; 
Fie on thee, wretch 1 *tis pity, that thou liv'ft 
To walk where any honcft men refort. 

S. Ant, Thou art a villain, to impeach me tha$« 
I*!l prove mine honour and my honefty 
Againft thee prefcntly, if thou dar*ft ftand. 

iV/ifr. I dare, and do defie thee for a villain. 



%% SCENE 



26o The Comedy ef EtiKOKn. 

s c E N je 'v II. 

£ff/^ Adriana, Luciana, Courfffsfni and others. 

Mr. Holdy hurt him not,; for 'Odd's iake i^ be 
mad \ , - 

Some g^t within htm^ take hit fword aW^y : 
Bind jyromto too, and bear them to my heofe. 
S. Dro. Run, mailer, run ; for God's fake, take a 
houfe ; 
This is (btoe Priory } in, or we are fpoil*d 

\E9Siun$ t0^ Priory. 



Enter Lady AJbbcb. . 

jOfb. Be quiet, people ^ wherefore throng you hi* 
tter? 

Adr. To fetch my pMr diflta&ed husband heocei 
Let us come in, that we may bind him faft. 
And bear Iiim home for his recovery. 

Ang. I knew, he was not in his per(e£l Wtts. ' 

Mer. Vm ibrry now, chat I did dmw%ii'him>' - 

jibb. How long hath this pofie^M hdd^ilftiiy^ 

jidr. This week be hath been htavy, fowe^i fid. 
And much, much difibirent from dbtmtthlf was: 
But, 'till this afternoon, his paiBon- ' 
Ne'er brake into extremity of rage. •- 

jibb. Hath he not loft much wealth 1^ wreck at fia ? 
Bury'd ibme dear friend ? hath riot dft his eye 
Stray *d his afTedion in unlawfuMove ? 
A Iin, prevaHing much in youthfU men. 
Who give their eyes the liberty of gazing. 
Which of thefc (brrows is he fubjea to ? * 

yidr. To none of thefc, except it be the lad i 
Namely, fbme love, that drew him oft from home; 

jibb. You ihould for that have reimhendcd him. 

Jdr. Why, fo 1 did. 

jibb. Ay, but not rough -enough. 



« 4 « , <■ - 



The Comedj^of Errors. 26b' 

Mr. As roc^ly^ as my modefty would let me. 

Jih. Haply, in private. 

AJr. And in aflonblies too. 

Jbb. Ay, btt Ml^nough. 

4dr. ^ k was the copy of our conference* 
In bed, he flepc not for my urging it ^ 
At board, he fed not for my urging it ; 
Alonei it was theicil:9e& of my tbeam ; 
In company, I cAen glanc'd at JCr 
Scill did I tell him, it was vile and bad. 

^b. And cterefore caoK it, that the man was mad. 
The teRom<:Iaaiouri of a jealous woman 
Poifon more deadly, than a mad dog's tooth. 
It ieems, his fleeps %ere hindered by thy railing ; 
And-thereof pomes it, that his-head is light. 
Thou fay'ft, hi) meat wasfaucM with thy upbraidings $ 
Uoqnkt aieals make ill digcftions > 
Thereof the raging fire of fever bred j 
And what's a fever, but a fit of madnels ? 
Thou iay^ft^ hk fports were hindered by thy brawls. 
^ Sww recreaww barr'd^ what doth enfiie, 
' Bat moodi&xaad 4ulJ j^elanchdy, 
[ * K^iulinan tQ grim and comfortlefs defpair ?3 

* Aodat beTiheoli ft huge infediaus troop 

* Of pale diftempcratur^» And foes to life. 
In mid, in fport, and life-preferving reft, 

1 // was tbi Copy ^9mr €$/^i9ci,'] We are not to anderftand 
tUs word here, as it ii now fifed, in oppofition to an ^r^insJ i 
any thioe done after a pattern ; but we are to take it in the neareft 
mk to die Latim Wora Ctpia, fir^m which it is derived. Jdrimnm 



would hj, her repreofs w«re the korden^ the fidnefs of her confe- 
viice, all the fubjed of her talk. And in thefe acceptations the 
word Ctpia was aied by Writers beibicoar Author's dme, as well 
as by Us oontemporarics. Mr. nt§imld* 

2 Kin/man io grim and comfort Ufs de^irT'\ Sbrnke^mr KOuld 
never make melancholy a maii in this line, and a female in the 
nen. Thb was the fbolifh xnfertion of the firft £diton* I 
have thocfive pat it into hooks, as fpurious. 

S3 To 



i69 * Tif(^ome^of^f.tLOKh 

To be difturb*dff would W9^Qt mm or bcaft; 
The confequence is then» thy jealous 6» 
Have feared thy husband from she ufe of wics. 

Luc. She never reprehend^ hicQ but mildly^ 
When he demeaned himfejif rough> rude and wildly { 
Why bear you thefe rebu)$es, p4^ anfwer nocP 
Jdr. She did. betray tne to my own reproof. 
Good people, enter, and lay hold on him. 

jfbb. No, not a aeature emor in my boufe. 

Mr. Then, let your fervants bring my husband 
forth. 

jfbb. Neither ( he took this pigoe for fanAuary, 
And it Ihall privilege him from your hands i 
*TiI] I have brought him to his wits again^ 
Or lo(e my labour in ailaying it. 

jidr. I will attend my husband^ be^his norfe, 
Diet his (icknefs, for it is my office ^ 
And will have no attorney but myfelf ; 
And therefore let me have him home with me. 

Jbb. Be patient, for I wijl not kt him ftir, 
'Till I have os'd th* approved means I have^ 
With wbolfome firups, drugs, »pd holy prayers 
To make of him a formal man again -, 
It is a branch and parcel of mine loath, , 
A charitable duty of my order i 
Therefore depart, and leave bin> here with mp. 

Adr. I will not hence, and leave my husband heic; 
And ill it doth hefeem your holioefs 
To feparaite the husband and the wife. 

j#*. Be (^uict and depart, thou Ihalt npt have him. 

Xmc. Compfein untp the puke of this indignity. 

lExii Abbefs. 

Jdr. Come, go ; I will fall proftrate at his fccr. 
And never rife, until my tears and prayers 
Have won his Grace to come in per&n hither \ 
And tak^ perforce my husband from the Abbefe. 

^er. By this» I thiok^ titt dial points a; five : . 

Anon^ 



TheXkmeiyof Errors. 263 

AiiOo« Fm iuitff tilt Puke himfelf in peifon * 
Comes cbU wav totbe mdaucboly vale ; 
The pla« of dcadi ud iomr exccotioo. 
Behind the dittbes of the abbey here. 

Afi^. Upon what caufi: ) 

Mer. lo fee a reverend '5>niar/^ merchant. 
Who pot miluakily {nto this bay 
Agsiinft the taws and (btutes of this town, 
Behoided'publickly for his o0cnce. 

^b%. See, where they coroe | we will behold his 
deajth. 

Ijuc. Knieel to the Duke^ before he pafi the abbey. 

S C E N E III. 

\ 

Enter the Duke; and jGgeon bare-beaded i tvitb tba 

Hcadfmanr and ether Officers. 

Duke. Yet once again proclaim it publickly. 
If any iricndf willbay the fum for him, 
He (hall tiocdie, 10 much we tender him. 

^. Jtftke, moft facred Duke, againft the Abbefs* 
Duke. ^6 is a virtuous and a reverend Lady ; 
It cannot be, that fiie hath done thee wrong. 
Jdr. May it -pleafeyour Grace, AnipbeHs myhuf- 
band, ^ J 
{ WhoAi I itiade lord of me and all I hadf 
At your important letters,) (his ill day 
A moft outrageous fit of madnefs took him 1 
That dcipVately he hurry*d through the ftroet. 
With him his bondman all^ m mad as he. 
Doing difpleafure to the citizens. 
By rulhing in their houfes ; bearing thence 
Rings, jewels, any thing his rage did like. 
Once did I get him bound, and ient him home, 
Whilft to take.order for the wrongs 1 went. 
That here and there his fury had committed : 
Anon^ I wot not by what ftrbng efcape, 

S4 Hb 



^64. ^^ CamtJjf tf Eib&oRi 

He broke from thofe, "iR«r tad the g^ard of him : 
. ' AnS, with his mad ^t^iidanc mad himlelf, 
^ch one with ireful pSllfldtr; wjth drw/^f^ords^ 
Met us again, and, miidl) bibnton Os,i^ •-'• * 
Chas'd u$ away ; 'till, raifing of more a|d^ 
We came again to bind-them ; (hen'thi^ fled 
Into this abbey, whither we purfu'd them 1 
And here ^e Abbeis Ihpts the ^tes oh^ us. 
And will hot fuffcr us to fetch him out,*^" -^ 
Nor fend him iForth, that we may bear him hence. 
Therefore, moft eracious Pu)ce, with thy command, 
Jjtt him be brought forth, and borne bence for help. 
Duke. Long lince thy hus1>and fervid me in my wan, 
And I to thee ineag'd a Princess word, 
(When thou didft niake him mafter of fhy bed J 
To do him all the grace aiid good Tcoufd. 
Go, fome of you, Knock at the abbey-gate ; 
And bid the lady Abbeft come to mei * **- i 
I will determine this, before I ftir^ .. r . - 

Enter a Meffetifft^ V'"' 

Meff. O rriiftrefejmiftrcfe, ihiYt,ar(l^^ 
M y mafter a^d his man. ane both broHcf; lf(4(^9 
Peaten the maids a-DOW£^ai}d^ ^^MP.^ ^^^'^^"<^^^ 
Whofe beard thejr have j|^*d oft MfiiKi^n^ of fire \ 
And cVer as it blaz'J, they threw on Jun^- . 
Great pails] of pu^dl^ffVf^to* quench ^t^^^^ ; 
My matter preac^Sf/siftW^ Wnp,^j sjn^fthfi w 
His man with toflp^nffl^p^fcim Jifcc jaifwl; 
And, fure, unlels yi^g^^^id. ibmc prffcnt'Belp, 
between . tjipn^ x^ey Vlli Jwi :?l^? ^^1^^* 



'• » > > 



3 Jndr nnith his mad attindant akd limjUfJ] We (hbulii'read. 



the Comedy tf Errors. 965 

Adr. Peace, fool, €hy nrnftcr and his man are htre^ 
>Lnd chat b iaUe^ (hou doft xqpovt to tit. 

Meffl MittK&^ Qpdn my Jtfe, I tell you true i 
I have not bitath*d almoft, fiooe I did fee it. 
He erys for yoii» and rows if be can take you, 
f To icocoh your fafie^ ^od to disfigure you. 

[Cry wihin^ 
Hark, hark, I httur him, miftrefs ; fly, be gone. 

Duke. CoflQC) ftand by me, fear nodiin^: guard 
wich halberds. 

jfdr. Ay me, it is my husband ; wicnefs you^ 
That he is borne about inrifible J 
£y*n now we housM him in the abbar here. 
And now he*s there, paft thoi^t dr human reafon« 

SCENE V. 

Efiter Antipholis, and Dromio of Ephefus. 

E. Ant. ]M^\ct^ mod gracious Duke, oh, grant me 
juflice. 
Even for the fervice (hat long fin^ I did thee. 
When I beftrid thee in th^ wars, and took 
Deep fcars to (ave thy life, even for the blood 
That then I loft for thee, now grant me juftlce. 

J£geon. Unlefs the fear of death doth make me dote^ 
I (ee my fon jlntipbotis^ and DromtQ. 

£. jint. Juftice, fweetPridcei ag^nft that woman 

diere: V 

She whom du>u gav'ft to me to foe my irife} ' 

That hath abufed and dlihohourV ine, 
£v'n in the ftrcngth and height of tnjurjr. 
Beyond imagination i$ tlie v;rong. 
That (he this day hath Ihanielefs thrown on me: 
I}kkc. Difcover how, and thou Ihalt find me ju(t 

4 7o sconcH j9ur ySrnr^--*] We fli«oU lead &ooTCHt i.#. 
hack, cot. 



266 TU^Gomedy i^Erkok$. 

E. A»t. This dly^ {[Mst Dukr, -ibe ihut die ^ors 
upon me } 
Whilft ibe with hariou leafled»Ay hoiife. 

Duke. A grievous fuik t fa]r» woomn^ dJdft tfcou M 

Adr. No, my good lofd : myftlf, he, Mk} my fiftcTi 
To day did dine togtcher : fo MU my ibul^ 
As this is falfe, he burthens me withal ! 

Luc. Ne*er may I look onilay» mr flctp on n]sbt» 
But Aietelb to your highoefi fiinplc truth t 

Ang. O perjurM woman ! they are both fbrfwcmi. 
In this the mad^man jufiJy cfuu-g^b them. 

E. Ant. My U^e» I am advifed» what I iay. 
Neither difturb'd with the eficA of wine, 
Nor» heady raih, provok'd with raging ire i 
Albeit, my wrongs might make one wifer mad. 
This woman locked me out this day from dinner ; 
That goldfmith there, were he not packed with hcr^ 
Could wionefs it ^ fer he was with me then ? 
Who parted with me to go fetch a chain^ 
Promifing to bring it to the Porcupine^ 
Where Baltbazap and I did dine together. 
Our dinner done, and he not coming thither, 
I went to feek him ^ in the ftreet I mtSi him^ ' 
And in his company that gentleman, ' 
There did this perjured goldfmith fwear me down. 
That I this day from him received the chain ; 
Which, God he knows, I faw not 5 for the which, 
He did arreft me with an officer. 
I did obey, and fent my peaf^nt homd 
For certain ducats ; he with nont returned. 
Then fairly I befpoke the officer. 
To go in ptrfon with me to my houle. 
By th* way we met ray wife, her fifhu*, and 
A rabble more of vile confederates 5 
They brought one Pmh^ a hungry kan-fac*d villain, 
> A norar anatomy, a mountebanky . 
* A thread- bare juggler, and a fortune-feller, . 

• A needy. 



7&f Qmijf tf EnftoRS. 267 

' A needy* hoUiwr<y*dr flurp-Iookiiig wretch* 
^ A living dead man.* This pernicioui flave, 
Forfooth* cook on him u acpigurer ; 
And, gfttiog in my tyo* fediag my px\fc^ 
And wkh tto^boct as 'cwcre* ouc-facsng me* 
Cries cut* I Wa9 pc^ft* Then all together 
They fell upon me, bound me, bore me cbence ; 
And in a dark tnd dankifb rziik at home 
There left me tod my .man, both bound together ; 
'Till, gnawing with my teeth my bonds afunder* 
I gainM my freedom, and tmmraiately 
Ran hither to your Grace ; whom I befeech 
To give me ample iatffi6&ion 
For thefe deep Ihames and great indignkies^ 

yi»g. My lord, in truth, tbui. far I witnefi with him i 
That he din'd not at home, buc was lock*d out. 

Duh. But had he fudi a chainof thee, or no? 

yivg. Hefaad, my tord ; and when he ran in here, 
Thefe people .ftw the chain about his- neck. 

Mer. Bcfidiss*. I tdU be fwom, thefe ears of mine 
Heard youiconlcft, you^htd tbe.chain of him» 
After you 6rft ibrfmxcr it on the mart ; 
And tfaereupoo I drew my iword on you ; 
And then you flei into th^ abbey here. 
From whoKfiiy I Amk* you^recome by miracle. 

E, AnU I Mwr caoie within thefe abbey walls^ 
Nor ever didft thou draw thy fword on me \ 
I never faw the chain, fo help toe heav'n ! 
And this is falfc^ you burthen me widial. 

Luke. Why* what aa intrk:ate xnipeach is this ? 
I think, you all have drunk of Circe's cup : 
If here you hooi^d kAm^ here he would have been % 
If he wer^ mad^ lie woukl not plead fo coldly : 
Youiay, he din*d ait home } the goidfmcth here 
Denies dis^ faying. Sirrah* what lay you ? 

£. Dro. Sir* he din^d with ker there, at the Per* 
'4ufme. 

Cour. 



* 

x6t Tie Cmedjf ^ if nil o r t. 

Caur. He did, and frooi kiy finger fnatch'd that 

ring. 
E. Ant. ^Tis true, my Li<ge^ this ring I had of ber« 
Duke. Saw'ft thou him enter ac the abbey here ? 
Cour. Aft fure, my Liege, as I do fee your Grace. 
DtAe. yf hji this 'is ftrange^.go call the Abbefi 
btther » 
I think, you are all mated, of ilaric maai 

[£m$ me 19 Oi jAbefs. 

S C E N'-E VL 

JEgeon. Moft mt^i^ Dake, voiKfaiafe me ijpeak 
a wcnti: c . ' 

Haply, I fee a friend, will fwe my Jifer . . 
And pay the fum tba^ may deiiver me. 

Duke. Speak firedy, 5yritfi^^ 
. JSgion. ' is ^Qt your name, ^, called JiU^Jbolis ? 
And is not that your bondsman Drmio? - 

£. Dro. Within this hour I w» Us bMd«4nan^ Sir^ 
But he, . I thank him, gnrar^d mvi^ my cords ; 
Now am I Dromio^ and his tnan unbound. 

Mgeon. I am furd, you bixh.Qf .ydu «enEMmber me. 

E. Dro. Our fel ves we do rememtaor, Sir^^ fay ifooL ; 
For lately li^ewisre bdund; asydaaie^novJ 
Yqu are not Pinch' h f>ati6ntv are youf Sir ? 

Mgeoft. Wjiy^look^uilrange em Biei you know 
me wcU^ - -./. ,'•..'.. 

E. Ant. I never faw you in my life, *till now. 

JEgetm:Qki\ grief Imh-chaAgfd me, finoe you law 
.n^e]aft.i . -^Z. 

Ary] caretui hours with time's defornled hand 
Have written ftrange defeatures in my fiux ; 
But tell me yet, doft thou not know my voice ? 

E. Ant. Neither. 

AEgefin. Dromio^ nor thou ? 

£. Dro. No, truft me, Sir, nor I. 



E.Dro. I, Sir? but I am fure^ Idonots andwhat- 
loever a man dnies» yoa are now boond to beliew 
liifii* 

JEg€9iu Noc ksK)w my toicc! oh, lime's extremity ! 
Haft thou ia Gnick*^ aod fplitted my pM( tongjoe 
in feven fhort years, that here my only ion 
Knows DOC m V feeble key of uaton*^ qares ? 
^ Tho* now this grained &ce of mine be hid 

* In (ap-confuming winter^s drizied fnow^ 

* And all the conduits of my blood froze up i 

* Yet hath my night of life ibme memory ; 

* My wafting lamp fome fiiding, glimmer left, 
^ My dull deaf ears a little ufe to hear : 

* ^ AH thele bold witnefifea I camiot err, ^ - .\ '. 
^ Tell me thou tut my ion ^ii^£i« ^ > ,1 

E. Ant^ i Msoer fawmy fiuher^ in my^ Ijife. ^ ^ 
jEgetm: But feuen yeara^finoe^ ifkSyrucUfih\»:jfM^ 
Thou kno w*ft^ we parted % bur^ perhaps, oqr fon» 
Thou fham^ t'Acknowkdge.me in milery. 
E. jbtt. .The Duke, and tji^ that know ifie in tb< 
cityi. : ': ' . , 

Can wunA wkh me that it is not ib: 
I DtferSkwSyraettfi^ in my life* 

Duke. 1 cell tfaae^ Syracufiuf^ twenty years 
Have I been Patron to Aiuifbotis^ 
During which time he ne'er iaw Syracujk: 
I fee, thy age and dangers make thee doac 

« « ^ 

^ All thtfi o LD nmwfftst I titnmt err^l I bcUere «re fluHiU 
read, AUthtfe hold tvitnejfes I cannot err ^ 
i. e. All chefe continue to teftif/ that I cannot erf, and tell mt, 
bfc. 



* "> . ■ • • 



<rceN E 



270 The Comiiy ofEKtLGKS. 

SCENE VII. 

Enter the Abhefs tvilb Antipholis Syracufan^ and Dro* 

fiiio Synciiian. 

Jhb. Moft mighty Duke, bebofd a man much 
wrong'd. [^jfll gaiber to fee bim. 

Air. I fee two husbands, or mine eyes deceive me. 

Huke. One of thele ixien is Gemus to the other ; 
And fo of thefe which is the natural man. 
And which the fpirit ? who deciphers them ? 

S. Dro. I, Sir, am Dromio ^ command him away. 

£• Dro. I, Sir, am Dromio i pray let me ftay. 

S. Ant. JEgeon^ art thou not ? or elfe his ghoft i 

S. Dro. O, my old mailer! who hath bound bim 
here? 

Abb. Whoever bound him, I will loofe his bonds i 
And gain a husband by his liberty. 
Speak, old AEgeon^ if thou be*ft the man. 
That hadft a wife once calPd ASmUia^ 
That bore thee at a burden two fair fons f 
Oh, if thou be'ft the iaooe jEgeon^ ipeak 1 
And fpeak unto- the lame JEmiiia. 

Duke. Why, here b^ns his morning ftory right: 
Thefe t\io AntipboK^s^ thefe two lb liice. 
And thofe two Dromio* s^ one in femblance i 
Befides her urging of her wreck at iea, 
Thefe plainly are the parents to thefe children, 
Which accidcDtalJy are met together. 

Mgeon. If I dream hot, thou art jCmiliai 
If chou art (he, tell me where is that fon 
That floated with thee on the fatal raft. 

jibb. By men of Epidamnum^ he and I, 
And the twin Dromio^ all were taken up ; 
Bur, by and by, rude fifbermen of Corintb 
By force took Dromio and my fon from them. 
And me they left with thofe of Efidamnum. 

What 



Tfk Comt^ of Errors. 271 

What then beoime of chem, I otniioc cell i 
I9 CO this fortune chat yoa fee me in. 

Duh. jbuipbotis^ thoo cain*ft from Carinib firfL 

S. ^. No, Sir, not I| i came from Syrscufe. 

Duie. Stay, (land apart) t know oot» which is whidi. 

£. A»t. I came from Cmntk^ my moft gracioya 
Lord. 

E. Dro. And I with him*. 

E. Aut. Brought to this town by that moft fitmous 
warrior, 
Duke Menapbon^ yactc moll r enow n ed uncle* 

yfir. Which of you two did dine with me to day ? 

S. Jbit. I, gentle mtftre& ' 

Adr. fixiA are not you my husband f 

E. Ani^ )^o» I fay «#y to thait 

S> Ant. And fo do I^ yet (he did call me fo : 
And ihis fair^entlewpman^ her fifter here* 
Did call me hrorher. ^ What I told you then, 
I hope, I ihall have leifure to make good) 
If this be not a dreamt I fee and hear. 

Aug. That is the chain, Sir^ whk;b yoo had of me* 

S. dnt. 1 (hink it be. Sir, I deny it not^ 

E. Ant. And you, Sir, for this chain arrcfted me« 

Anz. I think, J did. Sir \ I deny it not. 

Adr. I U9K y5»u'iDpnf, Sir, to be your h^il^ 
By Drcmio ; but, I think, he brought it oou 

E.Dr0. No^ none by me* «. • 

S. Ant. This purfe of ducats I reoeiv'd fiiom you, 
And Dnffiio my man did bring them mch 
I fee, we fiill did o^eet eaich other's man» 
And I was ta'en for hlmr and he for me. 
And thereupon chefe Errors all arofe. ■ 

E. Ant. Tbefe duca^ mwa I for my father here. 

Duke. It (hall noc need, thy father hath his life. 

Cour. Sir, I mufl: have chat diamond from you. 

E. Ant. There, take it \ and much thanks (or my 
good cheer. 
* > Abi. 



2^2 Uf.<SMf^i^^B9k^SHt, 

Abh. ReiiowDedt^i]ikC>vp|n^ltifttp^.takftcbc|nin9 
To go with us into cbenibfi^ hfre,:^ , , 
And hear at large difcouricd all our foitunet.: 
And all that are aflcH^iled ia.this.^la^^. 
That by this fympvj^vad «ae day's J^iw .■ 
Have fufiVd wroQg) ^ keep us c«vi)paD]r> 
And ye fluU have full fati«fa£tion. 
Twenty five years have ] but gone:in trtv^I .. 
Of you my Mas ) nor» 'tiU c|ms prefent-Jumir* - 
My heavy burdens arc delivered : 
The duke, my husband, and my children boch. 
And you the calendars of tbeir otdvity. 
Go to a goflip's fcaft ' aod gaude with me : 
After folong grief fuch nativity ! 

Duke. With all my heart, I'll gollip at this foft. 

SCENE Vllt 
Manent the two Antipholis's, and tw$ Dromio's. 
S. Z from Aip- 

£*J. ft thou- in^ 

S,D Sir, in the 

S.^ m matter. 

Come, _ in» 

Embrace ihy brother there, rejoice with him. 

[£x«ttff/Antipholis S. jin:/ £■ 
S. Dro. There Is a fat friend st your mailer's hoale, 
That kitcben'd me for you to day at dinner : 

6 ■ ' mtJoo vtithmt-] We Ihanld tm!* 
i. i. Rejoice, irom the fnach, Gamdir. 



Tfu CmeJy fff Errors. 273 

She now flull be my fifter* not my wife. 

E. Dn. Metbiniu, you ire my glafs, tod not my 
brother: 
1 lee by you, I am a fwcet-fiK^d youth : 
WiJI ywi w^k in to fee their goffiping ? 

S- Dro. Not I, Sir j you're »y ekkr. 

£. J>re. That's a queftion i 
How flull I try it ? 

S. Drv, We'll draw cots for the fenicH-; 
Till then, kad thou firft. 

E. Dre. Nay, then thoi- [Emh-aevigt 

We came into the world, like toother and brother; 
And DOW let's go htod in band, not ooe before another, 
{^Extunt. 



Vot. m. T THE 



I^» 






/«^ .#r 



• *. 



imisefeK3iesaKaB[sisi^^ 



THE 



W I N T E R's 



T ALE. 




T » 





s, ^Mg-'<scfiu. :, ■ 

«f Beilttinia. - >/««•» 



9^^.4 



- '"^ 



MimWfw; youn^g Prince if Sicilii; 
Florizel, PW«c<? c/ Bohemia: - 

Camillo, \ 

Cleomenes,( ^'Cihan Ij>rds. 

Dion, ^ 

Another Sicilian Lord. 

Archidamus, ^ Bohemiao Z^ri. ' 

Rogcro, tf Sicilian Gentleman. 

An Attendant m tbeymng Prince MaoitilltQSi 

Officers of a Court of Judicature. 

Old Sh^herd, reputed Father^ of Pcrdfpu. \ /> 

Cloivn^ bis Son. 

A Mariner. 

Goaler. 

Servant to the old Shepherd;, 

Autolicus, a Rogue. . -.^ . 

Time, as Chorus; ' *' '' ^ ^ ^ ! -^ 



Hermione, !^een to Lcdntes, ' - ,' -^ r; ; p^ " 
Ptfrdtta, Dauxhtepii>Leot\xe$ ondHem^ni. ^^'-k 



Paulina, ^^ /* AhrigohiM. - 

Emilia^, 'Aitendanton tbe^^n. -^^'-^i I ,?u»j 

Swo other Ladies. o. . . .;: : %^:? / *.;.,. 

Satyrs for a Dance ^ Shepherds^ Sbepberdejfes^ Guards, 

and Atendants. '- ' 

SCENE, fametimes in Sicilia j fimatimes^ in 

Bohemia. 

THE 



'THE 

WIN r E R's "t/IL E. 

ACT I. SCENE I. 

jin jinticbamber in Leontes'i Palace. 
. Enter Cimitlo and Arctudamus. 

Akchi oauus. 
i F yoQ Oialt chance, CamUlot to vi(it Be- 
s bevtia, on the like ocx;arton who-eon my 
B fervices are nov on foot ; you Ihait fc^e* 
g as J have laid, great difference betwixt 
^ our Bohemia apd your Siciiia. 
Cam. I think, this cpming fuowxr, the King of 
Siciiia means to pay Bohemia the vifitacion, which he 
juftly owes him. 

I 7ht WinirrU Tali ] Thi) play thnHighotit ti written in the 
very fpirit of iti anther. And in (tiling this homely and fimple, 
tfao' igrveable, country lale, 

Oitr/wtili/i ShakeCpear, /«•<;'/ ebild, 
WmrbUi hii naii-vt iinaJ aetti •wiU. MittOD. 

This wu oecel&ry to obferve in mere juilice to the Pky, it the 
neanacri of the &b1c, aod tbc exciavagant conduCl of it, had 
milled feme of gnat tume into a wrong judgment of its merit i 
which. «i &r at K regards fcotimeat and cliAradcr, it Icarce in- 
ferior to any in the whole collcfiion. 

T 3 Jt-cb. 



n 



X 

^r^i»« Wberein pur ttl|Slli«P)^t. (ii»U (ha«« qi» 
^ will be juftified in our lo?fif t fofi iad^,^«* 

. Anh. Verily, f fpegk it in the frfcdom ^ wg 
knowledge; w^caniiot wkfa fiieb naagnificenoa <» in 
fo rar^rr^ know not what tp iay — we will give you 
flecpy drinks, that yourfenfiis (unintelligent of our 
ipruificience) may, dio* they cannot pratfe us, as little 
aocufc u^. - . . 

Cam. You pay a grait deal tdodear, for what's 
giveii fircely* . « .^ 

Arcb. Believe me, I fpeak, as my Underftanditog 
inftrudts me ; and as mine iumefty^ pits itt(rtitaiianoe« 

Cam. Sicitia cannot (hew himu^ o^^rsbind to Sc- 
hernia ; th^y were train'd together in thloir diikihocxisi 
and there rooted betwixt theth then fuchaJdafitdiQa, 
which cannot chafe bi|t bnnch now* Stnceiilttir more 
mature dignities and roya) neceffiues-niiEldd fi^aiatbn 
of their fociety, their tncouimrs, thpug^iuBpceibnal, 
have been royally attcirnied with entecdiaitgeof kifib, 
letters, loving embaffies ; ihacthey1iAireittin1i%>be 
together, rho^ abfene^ ihook handsi a^ «w^a Vaft; 
and embra^'d, as k were^ from the and$ oii^ppaM 
wiiida. The heav'os continue their lovc^ 1 ~- 

Arcb. I think, there is net in the wi^rkl either ma- 
lice, or matter, to alter it. Yon have an vnfptekable 
comfort of your younff Prince jlfjmf//faj.^^' ilt is'a 
genilaKHi9.af the greateft prqpufe, that ever cat^e in- 
to my note.*. 

Cam. 1 very well a^ree with you in the hopes of 
him: it is a gallant child » one that, indeedt phyficks 
the fubjed, makes old liearu freih : they, that went 
on crutches^ ere he was bom, defire yet. their life KQ 
fee him a man. 

Arcb. WouW they elfc be content to die ? 

Cam. Yes, if there woM no otha excufe wky diey 
ihould dedre to live. 

Aixi. 






./i^rifr. If die Iting had iw' ibnt they Wdbld deftte 
ll»«-«ii ctiN^ ifit hr lad «M. 

S C E N E H; 

jEfl^rlxQorob Hermi6qe» Mamilliiis^ Fblixenes, 

and JiicndatUs. 

— ♦ . ^ < • 

Pa/. VT I N E Chan«s of the watry ftar ha^i been 
IN ^.(Tfe (hcpfatod'B nocei} fioc« we Uvft left 
our Tbranc 
WkfaOQC a.bilrthcii : dote at 1m§ agwi / '\ 
Would to AlM.it|i^ mjf farochcr, with our. thinks 1 
And yiBt. utrAouUi i6r pcrj^ftuiey^ 
Go horioiiiii.'ddK : m4 tMMfore^ like a cypher. 
Yet fbJMittg tri rkk^ ptafle^ I muJdplf . 
Wtthiotevwr tbmhjm4smn^ thoiiiaiidi nocc 
Thar.91 befioie jtw 
£AqScB)r;|nMtrthaiihi: a whilci 

. Aq^ paj^riheflby' i>th« ]N>a.parc. 

' oPtf/. ::!Siri tkacV K> tnonrojK : 

Itoi qoeftiai'dJif my ftiittt of what may chanoe^ 
.Ol4ycedupo»Qura2ifi)D£e^ ^ may there Uow 

2 niJB^htrtfiiofe, 3' f. ^ I ofe the Ih^^rd'i tccko^'fift- 
. .l^AMti9g,f9indf ai horn, ^.} ThU is ncpi»(en|e» ,wc flioald 

MAT THEIe bAlW, &C, 



He bad fatd &d was ^ippi^cnfiVt that iiis ptiTeAc^ liiSgfat te wttted 
at honei boc left this fhouki prove an oftiraocM ^Sach, lie te- 
deavoan^ a^ivay the ^mn» (o »wt it by a deprec^iory ptaye^. 
, — ;— HUM fi^e i/oiif 

' No ftif aping nvtnJts ' ' ■ /fl Mtfif ^ fio* 
fhh nvas fMt firti *^ irufy^^-'^^ 

Bat the Oj^^^^ Kditoi, nubcr tbfttt be beholden to thb c6iteftion, 
alters it to, 

■ ■ there nurf bhw 

Seme /lieafiiig 'ivhdi *■ ■ 
and h deftroyi tbt whole faitiiiient. 

T 4 N'o 



i 80 .IS* W I N T E jCs T A"l E. 

No fncapiog winds at h^me^ t<^ mtkeiis (ay, 

«« This IS put forth, coo^tryly.*" fttrfifikss, 1 have ftay'd 

To tire your royalty. 

Li0. We are coug^» brajier,. / 
Than you can put us to'r. 
Pol. No longer Stay. 
JJo. One fev'n-night longer. 
Pol. Very footfa, to morrow. 
Leo. We^ll part die time b^ween*s then : and in that 
Pll no g«in*(aying. .. . • . . % . 

' PoL Prefs me not^ 'befcecb you, ib ; 
There is no tongue that inoyts* nonr^ nonei i*th' world, 
So foon as yours, could wifvwe : ; (o it flioold now. 
Were there neccfficy Jo your feQ^cft•^aUho? 
•Twcre needful I deny'4.i^S My. affirtra ^^ 
. Do even.drag me hooiemrd »~ whiofeto hinder^ 
Were, in your love, a whip to me ; my ftay^/ 
To you a charge and ;n»ib^.; to £ive both, 
Farewci, our brother. r .-. u - 

Leo. Tongue-ty*d, opr Queeo? ipckkJpA. -' 
Her. I had thought. Sir, foVe heUiiXQ^pciice^^intil 
You'ad drawn oaths from him nottc^tftsryoi yoa,^Siri 
Charge him too coldly. Tell hino^ mq wosdhxrcii :i 
All in Bohemia^ % well: this fatisfg^EHoov 7c./ v:/. 
The by-gone day prpcLiim'dj fayihisM^himv - 
He's beat from his bed wacd. ij <i* i - { i 

Leo. Well faid, Hermone. 
Her. To tcU, he longs to fee his fori,;"*eit ftiPong," 
But kt him fay lb thenp and let hitn^gq;^' ; 
But let him fwear fo, and he ihall not (lay v " • 
We*U thwack him bence wnhdiftaiffs.^' 
Yet of your roya) prefence Ml advemtJi^ . [T^ ^<^ 
The bontxr of a week.- '^hcn ai Bshenm 
You take my lord, *l% give you my comroifikN^ 

The 



«nM*i 



.d.:^ 



7& WmrmV TalW- xSt 

To let hinithenra nMSrttl»5T»«Hftd tJie'geft'^*-- ' 
Pi«fi3i»d'for»i fuuh^ ^ ^rtj good heed; -Lw«/«, 
I love thee not a jar o'th' clock Schiftd' '"'.\\ 
What lady flic her lottlr^'^Yotffl ftay^^ -^ 
Pol. No, Madam. • ''// 



^t f f 



flifr. Nay, but you will? 

PoL I may not, verily. 

Her. Verily? ' , ^ 

You put file off with libber tows ; but;!,' 
Tho* you would fcek t'unfphere the ftarswi^i oaths, 
Sbould yet fay, •' Sir, no goihg: verity^ 
♦^ You fhali not go i" a lady's verily is 
As poceac ^ a lord's. Wilt you go, jet.^ '" ' ^^ 
Force me xxk keep you as a prifoncr, * •]^' * 

Not like a gueft; (b you fliall pay your ices. 
When yjoa depart, and ftveyour thanks. 'H6w fay 

yoB? V". 
My prilbnfifi or rty goeft? By your dread verily^ 
One of them you fliall be. 

Pgl. Xc^ui^Gwlt then. Madam : J * 

To be yoqTNjirifiancr, IhouFd import offending 3, * 
Whicb is for toolcfe cafic to commit. 
Than you cd poni(b. 

Her. Not your Goaler then, ' /^ 

Bat your kind Hoftefs; come, I'll queftion you 
Of my lord's tricks, and yours, when you wiere bQys: 

The Tcxb ki^fi^ biiuleri which. frltowv'i^ws.tlvo t/tkc&tf^fHi ft: 
For (he 'could not dij flie would g^e her hv«l>^nii^aff»#nii(Goil to 
Iti or hinder hittif^^f. ' The cominiffion is giv^f^i taxJ^fji^fftif^ ^ 
whom ihe » l^kiiag;^ to bt br hinder her husbaod.' 

5 — iebind the gefi"] Mn fheoi^U fays,' h can' Heither trace f 
mmrjuHUrfioMd thji ^rmfif ui^ ^hfr^filic. (kinks uLlhd^ld bt juft: 
Bat the word ^eft is fight, and fignijBff^ ftage^, OK ^rney. In 
the time of Rafar FtogyeJ/ej the ^ingV 9^S*^* s^ ^^ ^31}^ t>y ^he 
jounuilftoftdiem ifvthe HeraMV office, ^erfe called his gests ; 
fyom the old French word gists, Diver/orium. 

6 '"'^yet^ food bied^ L<ontes J /, ,<. yet tak« good heed, L«w- 
U$t to whac I lay. Which phrafe, Mr. Theobald not underilanding, 
he alcei^i it to. m/ ir^i 

You 



282 The WlNTER'^TAti. 

You were pretty lordings thto ? 

PoL We were, fair Queeo^ 
Two lads, that thought !;her^ was iiq moit behintl^ 
But fuch a day to morrow as to daf , 
And to be boy cternaL ^ 

Her. Was not my lord 
The verier wag o'th* two? 

Pol. Wc were as t winn*d lambs^ that did frisk i'th* ^uo. 
And bleat the one at th* other : what we changed. 
Was innocence for innocence ; we knew ndt 
The do&rine of ill-doing ; no^ nor dream*d» 
That any did : had we purfuM that life, 
And our weak fpirits ne*er been higher. reared 
With ftronger blood, welhould Ivive knfwcrM heaven 
Boldly^ Not guilty \ " th* impofition dcar'd. 
Hereditary, ours. ^ 

Her, B*f this we gather. 
You have tript fincc. 

Pol. O tny mod facred lady^ 
Temptations have fmcc then been born to*s :. fer ' ^ 
In thofe unfledg'd days was my wife a girt ^ *'^ J ' 
Your precious Iclf bad not then crofs*d fhe t'y(!s - , 
Of my voung play.fcllow. . '' ',. '' ' ':.. 

Her. • Grace to boot! "' ^'f'\ 






Htreditsfy 9m-$.'] i #. fetting afUle §^giiuilJBk^ teiag'«dM 
impofition horn the offnceof cior firft ptMot^i^flugto lisft 
boldiy -pnntded our i$imr^. to Iwavm. 
$ Grace to i^f 
Of this maif m €99€hfkm^ hjl jcm Jkjf, &€.} Pdixf$is bad 
&tdy cbfi £ttce the time of chUdhooo and iiundoehoe*, tii^tmtkms 
had gretAM /• M/» ; ior tBat, in th«t intenr&l, tb^ two Queeili Utett 
hecoine woineii. To each part ^of this obfcrvidofi the Qoeeii an- 
fwers in order. To that mttmptations ihd'rqplfei, G^oee H b&mf 
i /. cho* tt:mptatiofis have j^own up, yet I hdfi|e gfate too las 
kf-pt pace with chcm. Graet to b^y was a proverbial erpfeil«o 
on rhefe occafions. To cheotiier part, /he rejsiie^^ as for 9mr ten>pc« 
ing you, pray cake heed you draw fio concIUfipn\froifi thtttee^ Ibr 
that would be maidng your Qutco and me 4evii$j ^. 

Of 



The WintbrV Tale. 283 

OF this make no conclofion, left you fay. 
Your Queen and I are dtvil^.' Yec^ go on ; * 
Th' offences we have made you tib, we'll anfwer i 
If you firft finn*d widi us, and that with us 
Too did continue fauU } wd that you flipt not. 
With any but with us. 

Z^o. Is he won yet? 

Her. HcMl ftay^ my Lord» 

Leo. At niy requeft he would not! 
Hertnione^ my dearcft, thou ne'er fpok*ft' 
To better purpofe. 

Her. Never? ' 

Le9. Never, bat once! 

Her. Whaf? have I twice' faid well? when wasH 
before?' • ^ 

I pr'ythce, tell me 5 cram's with praife, aftd make*^ 
As fat as tame things : one good deed^ dying tongue-kf^. 
Slaughters a thoufand, waiting upon That. ' 
Oiar nraife? are our wages. Tdu may ride*s 
Witn one foft kfls a thoulatid furlongs, ere 
9 With fpur* wc heat an acre, but to th*^ goal. 
My laff good deed was to iritreat his ftay % 
What was my firft ? it has an elder lifter. 
Or I miftake you : O, would her name were Grace I 
But once before 1 fpakc to th' purpofe ? when ? 
Nay, kt nac hav't 5 I tong. 
• JLw. Why i' that was when ' 
Three crabbed months bad fit VPt'dthemfeivts to death, 

^J9^^y/jfttr wf htai an aer$, * 'BitirtiT goahj Tims this ptf- 
Uge h»f been always jx>imedi whi^iki It apikars, chattlie Eikon 
did not take die.Pdet*! cooceit. Tli^ imagined that. But to ih* 
^1^, mmt* haf'f9C9mt to th€ pkrpfi i)iyxi the fetife is ditfercat^ 
and £hun enough wlien the \ui€ is )[k)inted rhus, 

Witif ^ w hi^ an acrk, htteib^guU. 
4. #. good uiagq will win as to an/ thing; hax^ with ill, we flop 
ihort, even there where both oat intereft and our inclination would 
Otherwife have carried us« 

Ere 



284 Tie Winter'/ Tale. 

Ere I could make thee open thy white hand. 
And ckpe thyfelf my ioVe Ktbeo didft thou utter, 
•* I am yours for ever. 

J%r. 'Tts grace, jodeed. 
V/ hyi Jo vou now ; I've fpoke to th* purpofe twice 1 
The one for ever eam'd a royil husband i 
Th* other, for fome while a friend. 

Leo. Too hot, too hot " ■ \^^^ide. 

To mingle frieodflup far, is mingi^g bloods. 
I have tremor cor^ on me »*«->* my heait dances ; 
But not for joy — ^ nc^ joy .-—This entertainment • 
May a free fece put on ; derive a Itberty - 
From, heartinefs, from ixuinty, fertile^ bdfem) - *- 
JVnd well become the Agent : *t ms^, I ^ant ;, ^ ' 
But to be padling palms, and pinchiftg- fitigers, - 
As fiow they are, and making pradtis'd fmi)e». 
As in a looking-glafs *— ^ and then to figh, as ^t were 
* The mort o'th^deer ; oh, that is ^n«rtainmcfit . 
My bofom likes not, nor my brows'— -^AfiW5*iV/itf;<^ 

Arc thou, my boy? • "" "" 

Mam. Ay, my good lord. - '' 

Leo. r fecks I - . . : . ^. 

Why, that's my bawcock j what? hafiilC fiiiiitc&'d^tKy 
nofc? . ' . - 

They fay, k^s a copy out of mine. GonM^, captain. 

We muft be oeat; not neat, but cleanly, <:a]ptiaiiv^_ 

And yet the fteer, tbehieifer, andtheddf, - -^ 

Are all cailM mii/« . Still jvirginalling 

[Obfn^Mg ro\\xtnGi- and ^(StfsAcui^ 

Upon his|xdm ?~*^how now^- you WanbeAtMcatf! 

Art thou my calf ? . 

Mam. Ye^^ if yott will, my lord: 
Le,^. Thou want*ft a rough i»(h/ dind the lh&^ 
that I have, ;?..-:* 

To be full like me. Yet they fty; ^ zit 

1 Tbi mtri iih* dari^^^ A lefion upon the horn at tlie dcmtli 
of the deer. Mr. Vmhmld, 

Almoft 



Tie WinterV Tale* 285 

Almoft as like as eggs ; women fay fb. 
That will faiy any ^ing i bat wtre they falie. 
As ofer-dyM bliicks, ais winds, xs wato^ -, Ailie, 
As dice are to be wi{h*d, by one that fixes 
No bourne 'cwixt his and mine ; yet were it true 
Ta/ay^ thU kof were like rae: Come^ Sir page, 
JLook on merwitb yout welkin*eye, (Weet villain. 
Moft dear^ft, my coilop — can thy dam •— may*t be— 
lipogination ! thou doft ftab to th' center. 
Thou doll make poifible things not be (o held, 
Comoumicai'ft with dreams *— * (how can this be ?) 
With what's unreal. Thou co-a£kive art. 
And fdlow'ft Nothing. Then 'tis very credent. 
Thou may -ft conjoin with fomething, and thou doft» 
And T^t beyond commiffioji ; and I find it i 
And That Ei^ the infedlion of my brains. 
And hardnidg of my brows. 
. P0i. . WJjftt means Sui&a ? 
Hry He joflKthing fecma uoforled. 
PoL .Hpvr ? . my lord ? 

}Jo. What cheer i how is't with you, beft brother ? 
Her. You look. 
As if you held a brow of much Diftraftion; 
Are, not. you mov'd, my lord? 

Leo. No, in good earneft. 
How Ibmeames nature will betray its folly \ J ■ 
Its^tcndcrnefa! %nd make kfelf a paftime ' '^ 
To harder b^foms ] Looking on the Knes 
Of my boy's face, methougHts, I dkl recoil 
Ttw?ftty*three years, and law myftlf unbreech*d. 
In my green velvet coat; my dagger muafed. 
Left it fhould bice its mafter ; and fo prove. 
As ornaments oft do, too dangerous ; 
J|iow^ like, merhought, I then wai to this kernef; 
This fquafliy this gentleman. Mine honeft^ friend. 
Will you take ;ggs ior mboy ? 
.;, M^nt. % ^y, lord. Vlfc fight, ^^ 



V /. 



1: 



a86 Tie WI^^TER/ Ti^ft*. 

Leo. You wilU >pH)b ^P7 <nai> ^'s dole ! 
Myl^ocber^^ ... . , 
Are J0U So fond of ypt^ jpung ^rioc^^ a&. we 
Do fcem to be of our»? , ^ . • 

P^/. If at home. Sir, 
He's all my exercife^ my mirth, my matter i 
Now my fwom friend, and then mine enemy ^ 
My parafite, my faldier, ftates-man» all ; 
He makes a Jufyi day (hort as lumber \ 
And with bis varying cbildnefs, curea ia me 
Thoughts that (houtd thick my bloodf, 

Leo. So (lands this Squire . - k 

Offic'd with me : we two will watt;, fliy lord. 
And leave you to your graver fteps. £^aMmc^ 
How thou lov'ft us, (hew in our brotjbec^s }iircdcQme : 
Let what is dear in Sicily^ be cheap : . 
Next to thy lelf, and my young rover, h<?s,* . " * 
Apparent to my heart. 

Her. If you will ieek us. 
We are yours i'th' garden : fhairs attend you there ? 

Leo* To your own bents difpofe yoil; you'll be 
found. 
Be you beneath the sky : I am anglipg now, 
Tho* you perceive me not, how I give line ; 
Go to, go to. [4fide^^Urvif^ per. 

How (beholds up. the oebf the bill tci iub^! 
And arms her with the bo]dne(s of a jfii^ 7-.. \ 

[Exeunt VoWx. . Irttx/fif^^^^^ 

Moment teo.Miij^^i^C^m^ 
To htr allowing husband. Gone %^^4d|^^. \.\ 
Inch-thick^ knee-deep ^ o'er head aynOiWaK ajc 



brk'd 

one. 

Go, pUy, b^y, play r^ thy mother .jjays,. .and I ^ 
Play too ^ but (o di%rac'da :p9in^ w^^iiMac ^ilxj 
Will hifs me to my graver comempt aiid nhtmnt^ 
Will be my knel Go^ pl^y,'&oy;^p>^— c^^ 

been, ' ^ 

Or 



r 

2lr Wtntb^r'i Talb. 387 

Or I am much dooeit'd^ cmkM% ere now ; 
And flumy a man there is, even at this prefent^ 
Now whuc I fpeak thii, holds his wife by disarm. 
That little thinks» flie has been fluic*d in's ablenoe ; 
And his pond fiCh'd bj bis oesel neighbour, by 
Sir Smik^ Idaf De^;^ur; nay» therms comfort 

Whiks other men have gpoesi and thofe gates open'd» 
Aa mine, againft their wili Should all defpair. 
That have revolted wives, the tenth of manitind 
Would hang tbemielves. Pbyfick for% there is none: 
It is a bawdy plaqet» that wiH ftrike 
Where *cis preobirunaot ; and * *th poweriut: 
Many a tbonl^id of *s have the dimfe and f( 
Bow noWt boy? 

Afesi. I am like you, they fay. 

Lt0. Why; that*s fome comfort? 
What? Cjm//^ there? 

Ca^. Av. mj good Lord. 

.^^Gk> play, MamiiS9u-^th<3^*n an honeft man t 

[£w* Mamillius. 



'J/ 



$ C K N B m. 



Camii&; tli^ Great ,^ will yoc ftay kinger. 

Cam. '^^ had miicK ^ 
When vQu/c4ft Ouf^ k ftili came home. 

lifc;^iMno^i? 

Cm: i^vtdcid not.ftay at your petitions made; 
His jwfinefitnbVe materia).- " 

'/;<»;D!dft*pttcci?eic? ' 



a •""^^iifpMffift: ihiak itT After tUs thoe tre four jk. 

Hhmoit^^tetmmuhAtdrf, Ibick io by fome profljgttt player^ 
wkfeh I A«F9r<9l(hin^ ipi fa«pe no teamed cridck, or fine Izdy, 
l(p|| c(tenn tku>mralcd edition, lor our Jufing now and then 
Op jdiefiune oeoeftt^^' aai after liamgj^ivcn hit aottoe^ taken the 
lame Hbertjn 

They're 



288 Tie WiHTEK*i Tali. 

They'M bene with me aSraifi * w hifp ^ f iq g , toaa^bg 
Sicilia is a fo-foith ; 'tk br goae. 
When I Aull guft it laft. How cmik% Cmr^, 
That he did ftay i 

Cam. At the good Queen's entreaty. 

Lea. At the Queen's be't i good^ Aotdd be per* 
tincnt ; ■ ' 

But <b it is^ it is not. Was this taken 
By any underftanding pate but d)ine? 
For thy conceit is ibaking, will draw in 
More than the contmon blocks ; not nocied^ k% 
But of the finer natures ? by fome ferefah 
Of head-piece extraordinary ; tower mefles. 
Perchance, are to this bufinels purblind i &y . 

Cam. Bufinefs, my lord ? I think, noft 
Bohemia ftays' here longer. 

Leo. Ha?' 

Cam. Stays here longer. * • 

Leo. Atfj but why ? 

Cam. To Tatisfle your Highnefs, and ch' eotreatiei A 
Of our rooft gracious oiiftrefs. 

Leo. Sapsfie 
Th' entreatfes of your miftrcfs? fatisfie? 
Let That fufficc. Pvc trufted thee, CamUo^ 
With all the things ncareft my heart; 4s wdU* 
My chamber-cduncels, wherein, pricft iifce» dioit 
Haft cleansed my boiom : I from thee dtpacced 
Thy Penitent reform'd J but we h^ve bcM 
DcceivM in thy integmy | ,deceiv'<l 
In that, which leems fo. 

Ctf^. 'Be it forbid, my lord 

Leo. To bide upon't ; — ^Thou arc not booefts or. 
If thou indtn^ft that way, thou art a coward j 
Which'^hbies honefty behind, rcftraiaiflg 

. 3 — '^fijfring, rounding :] i. c. rfmnHnf^ in th$ $mt^ a pklft 
m ufe %t that time. But tH#t>;^i/ Eiliior norfcnoiAib tbtt. dM 
Che text to, ^ubiffrini nuni. 

Ffo»l 



" Jtrf <^inteic*KTale. 289 

A fervant grafted in aiyleflidife Truft, 

And cfainnCn^glieciit ; or ellea fool, 

That iccft a game plaid howc^ the ^ich ftake drawn« 

And tak'ft it all fer jcft. .• 

(^ffl^. IMtf fffadous lord, 
I may be negligent, fboliih and fearful ; 
In every one orthefc 00 man is frce^" 
But that hU negligence, his folly, feir, 
Amongft the nmtme doings of the world, 
^ Sometifiie pots forth. In your affairs, my lord. 
If ever I wcne wilful negligent. 
It was my feUfY if induftriouQy 
I play'd the fool, it wftsniy neghgence, 
mrivrighing^^reU the end ; If ever fiarfiil 
To do a thing, where I the iBue doubted^ 
Whereof the execution did cry out 
Againft the non-performance, 'twas a fear ' 
Which oft infefts the wifcft ; thefe, my lardp 
Atefiich*aM6w*d infirmities, that honefty 
Is never free of. But, 'beitech your Grace, 
Be plainer with me, let me know my . trel^alt 
By its own viii^ 1 if I then deny it, 
*Tis none ofinine. * "* 

I^e?. Ha*ft«>ioa'f€en, Oi^/SH ' ' J 
(But tfaatfa paft doubt, youh^ve 1 or your eye-gTafi 
Is thicIflerriMin^a Ctickdld^s horh ;) of heard, 
(For to a vi0oii fo appatcnt, rlimour 
Cannot be mute or thought, ]1bi- cogitation 
Rrfides not in that man, that dcf s not think it ;) 
My wife is Dippcry? if thou wflt, cOnfefsj ' 
(Or elfe be" impudently negative. 
To have, nor eyes fi6r ears, nor tfioaght^) tfiea'&y, 
Wy wife's a hpbby-horfe, dtfefves a name^* ' 



^-> 



v.- «*. 



iVot.. IlL U As 



ago Pf V^^^f^fV TAtB. 

Asr^nk as any ^x•wfQ(b,.]^atp^t$tb 
Before her troth-plijg^ :' (ky\t, and juftify*t. 
* Cjm. I ttrould npt be a UAnder-l^, to bear 
My fovereign Miiljtrefs clouded fb^ without 
IMy prefent vengeance taken ; *fhrew my hsftt^ 
You never ipokc what did become you kfk 
Than this ; which to reiterate, ^ were fin 
As deep as that, tho* true. 

Leo. Is whifpering nothing ? 
Is leaning cheek to cheek ? is meeting nofes ? 
Kiffing with infide lip ? flopping the career 
Of daughter with a Iigh ? (a note infallible 
Of breaking honefly :) horfing foot on foot ? 
Skulking in corners ? wifhing clocks more fwifi? 
Hours, minutes ? the noon, midnight, and all eycf 
Blind with' the pin and web, but theirs ; tfaeirs only, 
That would, unfeen, be wicked ? is this nciihiog? 
Why,.tbcn the world, and all that's in't^ isnomingi 
The covering sky is nothing, Bohemia nothing ; 
My wife is nothing ; nof nothing have the^ notbiog% 
If this be nothing. 

Cam. Good my lord, be cur*d 
Of this difeas'd Opinion, and betimes % 
For 'tis moft dangerous. 

Leo. Say it be, 'tis true. 

Cam. No, no, * ipy lor<3. 

Leo. It is ; ybu lie, you lie : 
I fay, thou lieft, Camitto^ and I hate thee; 
Pronounce thee a grbfs lowt,. a mindlefs flave^ 
Or elfe a hovering temporizer, that 
Canft widi thine eyes at once tee good and Cf^M^ 
Inclining to them both : were my wife^s liver 
Infeded, as her life, flie would not live 
The running of pne glais. 



voir § fin 



As diif as tbatf tbei* trut, ] /. #. Your fafpicion is as greats 
fin is would b« that (if oominitted) for whkh you fofged her. 

Cam. 



Tffe WiwtirV Taib^ tgt 

Cam. Who do's infeft her i 
Leo. Why he, that wears her like his medal> baD^ag 
About his neck ; Bohendai-^-^^)xo^ if I 
Had fervants true about me, that bore eyes 
To fee alike mine honour, as their profits. 
Their own particular thrifts, they would do That 
Which ihould undo more Doing : I, and ihoa 
His cup-bearer, (whom I from meaner forme 
Have benched, and reared to worihip; who may*fl:ie^ 
Plainly, as heav'n fees earth, and earth fees heaven. 
How 1 am gall'd thou might'ft berfpioe a cup. 
To give mine enemy a lafting wink ; 
Which draught to me were cordial. 

Cam. Sir, my lord, 
I could do this, and that with no ra(h potion^ 
^ But with a lingring dram, that fhould CM>t worli^ 
Malicioufly, like poilba : but I cannot 
Belkve this cr^ck to be in my dread miftreiSj 
So fovercignlv being honourable. .• '. 

Leo. I've lov'd thee. — ^Makc't t^y Qucftioi>, ftn^ 
go rot : 
Do' ft think, I am fo muddy, fo unfettlcd. 
To appoint my felf in this vexation ? Sull/ 
The purity and whicenefs of my Iheets, 
(Which to preierve, is deep \ which being. (potted^ 
Is goads, thorns, nettles, tails of wafp^ :) 
Give fcandal to the blood o'th' Prince, my Ton, 
Who, I do. think, is mine, and love as mine, 

6 But tviib a airing iramt ihaifimdd not tnorkf 
MdUidoufy, itki fQt/tm ;— ] The thoaght u here beautifiillv 
ezpreflbd. He couki do k wi& • dram that ihoukl hft^ none i« 
thofc vifiUe efiefis that ditta the poifoner. Thefe efleds he finelf 
caUs the malicious workings of poifon, ^s if done with defiffn to 
titra^ the ufer. Bat the Oxford Editor would aieod Sbakijfmr^ 
cxpreffioDy and reads, 

• ■■ ihatflfwld mt v09ri 
tiki a md/Ui9Mi f$ifin:»-^ 

So that CamiIlo*s reafon it quite loft in this happy emendation* 

U 2 With- 






29a ^' '^ IN t * ^^^ ^A ^^^ 

Without ripe tnoyuig to't I would I do this f 
K^ouid man lb blench ? 

Cam. I muft believe you» Sir ; * 
I do, and will fetch off Bohemia for't : 
Provided, that, when he^s removed, your Highnefi 
Will take again your Queen, as yours at firft. 
Even for your fon^s fake, and thereby for fealing 
The injury of tongues, in Courts and Kingdoms 
Known and ally'd to yours. 

Leo. Thou doft advife me, 
Ev^.fo as I ipine own courfe have fet down: 
ril give no blemifh to her honour, none. 

Cam. My lord. 
Go then *, and with a countenance as clear 
As friendlhip wears at feafts, keep with Bohemia, 
And with your Queen : L am his cup-bparer % 
If from me he have wholefome beveridge, 
Accoiint me not your fervant. 

Leo. This is all ; 
S^tj 'and thou haft the one half of my heart i 
Do't not, thou fplit'ft thine own. . . 

Cam. VU do't, my lord. 

Leo. I will feem friendly, as thou haft advis'd me. 

[£«/. 

^tf/^.^Pinilerable lady ! but, for me, 
What cafe fland I in ? I muft be the poifoQer 
Of good PoUfeeues^ and my ground to do*t 
Is the obedience to a mafter ; one, 
Who, in rebellion with himfelf, will have 
All that are his, fo too. To do this .deed,, 
promotion follows. If I could find example 
Of thoufands, that had ftruck anointed Kings, 
And flourifh'd after, Td not do't : but fmce 
Nor brafs, nor ftene, nor parchment, bears not one ; 
Let villany itfelf forfwear*t, I muft 
Forfake the Court s to do% or nOy is certaia 






To 



jtbe WiHtbrV TALt: ^93 

To me a break*neck. Hapfij ftar reign now ! 
Here comes Bohemia. 

SCENE IV. 

Enter Polixenes. 

Pol. This isftrange! methinks. 
My favour here begins to warp. Not Ipeak ?— ^ 
Good day, Camillo. 

Cam. Hkil, moft royal Sir ! 

PoL What is the news i*th* court ? 

Cam. None rare, my Lord. 

Pel. The King hath on him fuch a countenance. 
As he had loft ibme province, and a region 
Lov'd, as he loves bimfelf : even now I met him 
With cuftomary compliment, when he, ■ 
Wafting his eyes to th* contrary, ai^d falling 
A lip of much contempt, fpeeds from m^, and 
So leaves me to confider what is breed ing. 
That changes thus his manners. 

Cam. I dare not know, my Lord. 

Pol. How, dare not? do not? do you know, and 
•dare not? 
Be intelligent to me, 'tis thereabouts : , -^ 

For to yourfclf) what you do know, you muft ) * 
And cannot £ty, you dare not. Good Camilhj ^ 
Your changed complexions are to me a mfrro^, 
Which (hews me mine changed too; for I niuft be' 
A party in this alteration, finding 
Myfelf thus altfcr'd with it;. 

Cam. There is a. fickneft • '- 

Which puts fome of m in difl^mper \ but ^ 

I cannot name the difeafe, and it is caught ^ 

Of you that yet are A¥eil. 

Pol. How caught of me ? 
Make me not fighted like the bafilisk. 
I've look'd on thoufands, who have fped the better 

U 3 By 



294 ll<^ Wi NT fe rV it a ^«. 

By my legird^ but kiiM none fo : Camilh^ 

As you are certainly a gentlema^^ 

Clerk^like expericnc'd, (which no lefs adorns 

Our gentry > tnan our parents' noble names. 

In whole fuccefi we are gentle ;) I befeech you. 

If you know aught, which does behove my knowledge 

Thereof to be informed, imprifon't not 

In Ignorant concealment. 

Cam. I may not anfwer. 

Pol. A ficknefs caught of me, and yet I well ? 
I muft beanfwer^d. Doft thou hear, Camilloj^ 
I conjure thee by all the parts of man. 
Which honour does acknowledge, (whereof the leaft 
Is not this fuit of mine,} that thou declare. 
What incidency thou doft. guefs of harm 
Is creeping towards me ;, how far off, how near } 
Which way to be prevented, if it be ; 
If not, how beft to bear it* 
^ Cam. Sir, I'll tell ypu. 
Since I am charged in honour, . and by him 
That I think honourable ; therefore, mark my coanftl ; 
Which nuift beev*n as fwiftly. followed, as 
t mean to utter it ; or both yourielf and me 
.Cry loft, and fo good night; 

Pol^ On, good Camillo. 

Cam. I am appointed Him to murder you. 
' PgL By whom, CamiUo f 

Cam. By the King. 

Pol. For what? 

Cam. He thinks, nay, with all confidence he fwears, 
As he had feen't, or been an inftrument 
7 To vice you to't, that you have toucht his Queett 
Forbiddenly. 

PoL Oh, then, my beft blood turn 
To an infe&ed gelly, and my name 

7 To vice jpffir /tf'/,-— ] i.* e, to draw, perTtttde yoo. Th* di- 
nQor called tiie Vict, iaciie^M pkyv wasciid T/a^ir to^cviii 

Be 



The tKfiNTERV Tale: 495 

Beyoak'd with bis, that did betray the beft! 
Turn then my freiheft reputation to 
A favour, that may ftrike the duUefl: npllril 
Where I arrive ; and my approach be Ihun'd, 
Nay, hated too^ worfe than the great*ft infedion 
That e'er was heard, or read ! 

Cam. Swear (a) this though over 
By each pardcuiar ftar in heaven, and 
By all their influences ; you may as well 
Forbid the'lea for to obey the moon. 
As or by oath remove, or counfel (hake, 
The iabrick of his folly ; who& foundation 
Is pird upon his faith, and will continue 
The (landing of his body, 

PoL How Ihould this grow ? 

Cam. I know not i but, Tm fure, 'tis fafer to 
Avoid what's grown, than queftion how 'cis born. 
If therefore you dare truft my honefty,' 
That lies incloied in this trunk, which you 
Shall bear alon^ impawned, away to night ; 
Your followers I will whilper to the bufinefs 5 
And will by cwoes, and threes, at feveral pofferns. 
Clear them o*th' city. For myfelf, Til put 
My fortunes to your lervice, which are here 
By this difcovery loft* Be not uncertain ; 
For by the honour of my parents, I 
Have uttered truth ; which if you feek to prove, 
I cUre not ftand by ; nor fhall you be fafer. 
Than one condemned by the King's own mouth *, 
Thereon his execution fworn, 

PoL I do believe thee : 
I faw his heart in's face. Give me thy hand ; 
Be pilot to me, and thy places fhall 
Still neighbour mine. My (hips are ready, and 
My people did expedt my hence departure 

f {at this though^ Mr. TTicobald— — Vulg. hit th$ught.'] 

U4 Twa 



P96 Ti&tf WiNTHV* XhLii 

Two days ago,— This jealoufic . 

Is for a precious creature ; as fhe's rar^, 

Muft it be great ; and, as his perfon's mighty. 

Mull it be violent i and, as he does conceit^e 

He is difhonour'd by a man, which ever 

ProfefsM to him ; why, his revenges muft 

In That be made more bitter. Fear o'er- (hades me: 

* Good expedition, be my friend, and comfort 

The gracious Queen's ; part of his theam, but nothing 

Of his ill-ta'en fufpicion ! Come, Camilh^ 

I will refped tt^ee as a father, if 

Thou bear'ft my life off hence. Let us avoid. 

Cam. It is in mine authority to command 
The keys of all the pofterns : pleafe your Highnefs, 
To cake the urgent hour. Come, Sir, away. lExeunt. 



A C T II. S C E N E I. 

ne PALACE. 

Enter Hermione, MamillJus, and Ladies. 

Her mion e« 

TAKE the boy to you ; he fo troubles me^ 
•Tis paft enduring. 
1 Lady. Come^ my gracious Lord. 
Shall I be your play-fellow ? 
Mam. No, Til none of you. 

I Lady. 

8 G^t9ipe4kionlimyfriimdf andt^mfirt 

The gracious ^uien ;-< ] fiut how conld his ezpedidoi 

comfort the Queen } on the contrary it would increafe her Hitf- 
tand's rofpicioB. W« iboul4 read, 

— — and ccmfori 

fii groiioMs Queen*8 ; -*<«« 

r. #. be fxpc4id9i| my friend, and be comfort the Qnce&*s frimd. 



Tie WiM«Bii'/ Talf7 297 

1 Lady. Why, my fweecLord ? 

Mam. You'll iciis me hard, and fpeak to me as if 
I were a habf ftiU ; I love you better* 

2 Ztf^. And why ib, my Lord i 
Mam. Not for becaufe 

Your brows are blacker ; (yet black brows, they iay. 
Become fiune women bdft ; fo that there be not 
Too much bair there, but in a iemicircle. 
Or a half-moon made with a pen.) 

2 Ladf. Who taught you this ? 

Mam. IleamM it out of women's feces ! praynow^ 
What colour be your eye-bro^sf 

I Lady. Bioe, my Lord. 

Mam. Nay, that's a mock : Pve ieen akdy's nofe 
That has been blue, but not her eye-t»rows. 

1 Lady. Hark ye. 

The Queen, your mother, rounds apace : ' weTHall 
Prefent our fervices to a fine new prince 
One of thele days ; and then you'll wanton with us. 
If we would have you. 

2 Laify. She is ipread of late 

Into a goodly bulk ; (good time encounter her^) 

Her. What wifdom ftirs amongft you ? come, Sir, 
now 
I am for you again. Pray you fit by us. 
And teirs a tale. 

Mam. Merry, or fad, Ihatrt be ? . 

Her. As merry as you will. 

Mem. A fad tale's bed for winter. 
I have one of fprights and goblins. 

Her. Let's have that, good Sir. 
Cbmeon, fit down. Come on, and do your bed 

The Oxfiri Editor has thonght fit to paraphrafe mjr correAion, 
and fo reads. 



Heaven comfiri 



To 



29^ TheV^iUfi rV T a l »•- 

To fright me with your iprights : you*rc powerful 
at it. 
Mam. There was a man" 
Her. Nay, come fit down ; then on. 
Mam. Dwelt by a church-yard ; •— ^- I will tell k 
foftly : 
Yond crickets fhall not hear it. 
Her. Come on then, and give't me in mine ear. 

SCENE 11. 

Enter Leontes, Antigonus, and Lards. 

Leo. Was he met there ? his train ? Camillo with 
him ? 

Lord. Behind the tiift of pines I met them ; never 
Saw I men fcowr fo on their way : I cyM them 
Even to their (hips. 

Leo. How bled: am I 
In my joft cenfure! in my true opinion \ 
Alack, for lefler knowledge, how accursM 
In being fo bleft ! " There may be in the cup 

A fpider fteep'd, and one may drink; depart. 

And yet partake no venom ; for his knowledge 
*' Is not intefted : but if one prefent 
*' Th* abhorr'd ingredient to his eye, make kno^ 
^ How he hath drunk, he cracks his gorge, his fides 

** With violent hefts. I have drunk, and fccn 

the fpider.——— 
Camillo was his help in this, his Pander : 
There is a plot againft my life, my crown ; 
All's true, that is miftrufted : that falfe villain. 
Whom I employed, was pre-employ'd by him : 
^ He hath difcover'd my defign, and i 

Remain a pinched thing ;«— — } AlladiBe to the fupermO- 
on of the vulgar, concerning thofe who weit enchanted, and ftfies* 
edto thefpoty by charms foperiortb theirowiw 

' Hbtnaio 



4C 



Tbi WiktirV Talb^ 29^ 

Remaiii a pinched thing ; yea» a very trick 
For them to play at will : how came the poftems 
So eaiily open ? 

Lord. By his great audiority. 
Which often hadi no lefi prevaiPd than fb 
On your oommand. 

Leo. I know*t too well. 
Give me the boy i Vm glad^ you did not nurfe him : 
Though he does bear fome figns of me, yet you 
Have too much blood in him.-*-—* 

Her. What is this, fport? 

Leo. Bear the Boy hence, he fhall not come about 
her 5 
Away with him, and let her fport herfelf 
WithJ|Mf fhe^s big with : for *tis Polixenes 
Has (Sue thee fwdl thus. 

Her. But I'd fay, he had not ; 
And, I'll be fworn, you would believe my faying, 
Howe'er you lean to th* nay ward. 

Leo. You, my lords. 
Look on her, mark her well ; be but about 
To lay, fhe is a goodly lady, and 
The juftice of your hearts will thereto add, 
•Tispity, file's not honcft, honourable: 
Praiie her but for this her without-door form, 
(Which on my faith deferves high fpeech,) and ftraight 
The (hrug, the hum, or ha, — (thefe petty brands. 
That calumny doth ufe : oh, I am out, — 
That mercy ao's ; for calumny will fear 
Virtue it fclf.) Thefe flirugs, thefe hums, and ha's. 
When you have laid file's goodly, come between. 
Ere you can fay file's honeft : but be^t known, 
(From him, that has moil caufe to grieve it fiiould 

be;) 
She's an adultrefs. 

Her. Should a villain fay fo. 
The moft repletlifii'd vilUin in the world. 

He 



-1 



300 The WinterV TalI!; 

He were as much more Villain : you/ my lord. 
Do but miftake. 

Leo. You have miftook, my lady, 
Polixenes for LeotUes, O thou thing. 
Which ril not call a creature of thy place. 
Left barbarifm, making me the precedent^ 
Should a like language ufe to all degrees ; 
And mannerly diftinguifhment leave out 
Betwixt the prince and beggar. — I have laid. 
She's an adultrefs \ I have faid with whom : 
More ; (he's a traitor, and Camillo is 
A federary with her ; and one that knows 
What (he (hould fhame to know herfelf. 
But with her moft vile Principal, that (he's 
A bed-fwcrvcr, even as bad as tho(e 
That Vulgars give bold'ft titles \ ay, and privy 
To this their late efcape. 

Her. No, by my life. 
Privy to none of this : how will this grieve you, 
When you (hall come to clearer knowledge^ that 
You thus have publifh'd me ? gentle my lord. 
You fcarce can right me throughly then, to iay 
You did miftake. 

Leo. No, if I mi(bke 
In thefe foundations which I build upon, ' 

The center is not big enough to bear 
A (chool-boy's top. Away with her to ^rifon : 
He, who (hall fpeak for her, is far off guilty. 
But that he fpeaks. 

Her. There's fome ill planet reigns $ 
I muft be patient, 'till the heavens lode 
With an afpeft more favourable. Good my lords, 
I am not prone to weeping ; (as our (ex 
Commonly are,) the want of which vain dew. 
Perchance, (hall dry your pities \ but I have ' 
That honourable grief lodgM here, .which burns ^ 
Worie than tears drown : 'befeech you all, my londs, 

With 



rf«"» 



Thi WinterV Tale. 301 

With thoughts fo qualified as your charities 
Shall bcft inftruft you, meafure me; and fo 
The King's will be pcrformM I— 

Leo. Shall I be heard ?— 

Her. Who is% that goes with me ? *befccch your 
Highneis, 
My women may be with me, for, you iee. 
My plight requires it. £>o not weep, good fools. 
There is no caufe ; when you fhall know, your miftrels 
Has deferv'd prifon, then abound in tears. 
As I come out ; this a&ion, I now go on. 
Is for my better grace. Adieu, my lord, 
I never wiih'd to fee you forry ; now, 
1 truft, I fliall. My women, — come, youVe leave. 

Z>eo. Go, do your bidding ; hence. 

[Exit Queen, guarded} and Ladies. 

Lfird. 'Beieech your HighneJs call the Queen again. 

Ant. Be certain what you do. Sir, left your jufKce 
Prove violence 5 in the which three Great ones fuffer. 
Your felf, your Queen, your fon. 

Lord. For her, my lord, 
I dare my Jife lay down, and will do^t. Sir, 
Pleaie you t'accept it, that the Queen is fpotlcls 
I'th' eyes of heaven, and to you, (I mean. 
In this ^hich you accufe her.^ 

Ant. If it prove 
Shei's otherwiie, Pll keep my * ftable-ftand where 
I lodge my wife. Til go in couples with her: 
Than when I feel, and fee, no further truft her j 
For every inch of woman in the world. 
Ay, every dram of woman's fle(h is falfe^ 
If (he be; 

Leo. Hold your peaces. 

2 -^abli'Jtmi^l Scab]e*ftaiid is a term of the foreft laws, 

and figaiMs a place where a deer-ftealer fixes his fiand, and keeps 
watch for the purpofe of kiUiog deer as they paft hy^ Osefird 
BJiimr. 

Lord. 



ooj 2*^ WintjilV Taie. 



Zor/j. Good my lord,- 



mm^nmm' 



Ant. It is for you we fpeak, not for ourfelv^ : 
You arc abus'd, and by fome putter^n. 
That will be damn*d for'c ; 'would I Jknew the villain, 
I would land-damm him : be ihe honour-flaw'd, 
1 have three daughters ; the eldeft is eleven y 
The fecond, and the third, nine^ and fome five % 
If this prove true, they'll pay for't. By niine hoaoiiry 
ril geld 'em all : fourteen they (hall not fee. 
To bring falie generations \ they ^e cohdrs. 
And I had rather glib myfelf^ chw th^ 
Should not produce fair ilTue* 

Leo. Ceafe; no more: 
You fmell this bufinefs with a fe|i^ as cold 
As is a dead man's nofe ; I (e^t and fia(l% 
As you feel doing thus ; and kn withal 
The inilruments that feel. 

Ant. If it be fb, 
We need no grave to bury honefty ; 
There's not a grain of it, the &ce to Iwcetea 
Of the whole dungy earth. 
Leo. What ? lack I credit ? 
Lord. I had rather you did lack than T, my lord. 
Upon this ground ; and more it would content me 
To have her honour true, than your fufpicion'^ 
Be blaip'd for*t, how you might. 

Leo. Why, what need we 
Commune with you of this ? but r^iXi^ follow 
Our forceful inftigation? our prenogatifc 
Calls not your counsels, but our natural goodnef) 
Imparts this ; which, if you, (or ftupified^ 
Or feeming fo, in skill,) cannot, or will not 
Relilh a truth like us % inform your felves. 
We need no more of your advice ; the matter. 
The lofs, the gain, the ordering on^, is all 
Properly ours. 
Jlht. And I wifh, my Liege, 

You 



7hf .Wl»TE;R> TaII- 303 

Too had only in your filent jadgmenc try*d it. 
Without rogre overture. 

Leo, How could that be ? 
Eidicr thou art moft iejiorant by age, 
Or thou wert bcmi a fool. Camlla's flighty 
Added to their ^miliarity^ 
(Which was as grofs as ever touched coi^edure^ 
That lack'd fi^t only i nought for approbation^ 
iftut only lee^g ; all other circumftances 
Made up to th' deed) doth puih on this proceec^ng ^ 
Yet for a ]greater confirmation, 
(For, in an a^ of this importancey 'twere 
Moft piteous to be wild) I have difpatch*d in poft. 
To lacrcd pelpbos^ to ApoUf^s temple, 
CUomines and Dum^ whom you know 
Of ftuflfd fufficiency : Now, from the .oracle 
They will bring all : whofe ipiritual couofel had» 
Shall ftop, or fpur me. Have I done well? 

Z^i. W ell donci my Lord. 

Leo. XhpM ^m &tisfy'd, and need no more 
Than what I know, yet fiiali the oiade 
Give reft to th* minds of others ; fuch as he^ 
Wfio^ igporapt credulity will not 
Come uj>,to. th' truth. So have we thought it good 
From our free perfon, ihe Iho^ld be confin'd ; 
Left that the treachery of the two, fled henoe. 
Be left her to perform. Come, follow us. 
We are to (peak in publick \ for this bufinefs 
Will raife u$ alL 

Ant. To laughter, «as I take it* 
If the good truth were known. lExamt^ 



SCENE 



394 ^^ Winter^ Tale. 

SCENE III. 

Charges to a Prifin. 

Enter Paulina, and a Gmikman. 

PW.'npH E keeper of the prifon, call to him : 

1 [Exit Gentleman. 

Let him have knowledge who I am. Good lady. 
No court in Europe is too good for thee ; ^ 
What doft thou then m prifon? now, good Sir, 
You know me, do you not ? 

Re-enter Gentleman^ with the G$aler, 

Goa. For a worthy lady. 
And one whom much I honour. 

Pind. Pray you then, 
Condufb me to the Queen. 

Goa. I may not. Madam ; 
To the contrary I have exprefs commandment. 

Paul. Here's ado to lock up honefty and honour 
from 
Th* accefs of gentle vifitors ! Is^t lawful, pray you. 
To fee her women ? any of them ? EmiTm f 

Goa. So pleafc you, Madam, 
To put a- part thefc your attendants, I 
Shall bring Ennlia forth. 

Paul, I pray you now, call her : 
Withdraw yourfclves. [EMeunt Gent. &a 

Goa. And, Madam, 
I vmii be prefent at your conference. 

Paul. Well ; be it fo, pr'ythec. 

Enter Emilia. 

Here's fuch ado to make no ftain a fiaio, 
A3 pafles colouring. Dear gqitlewoman. 
How fares oqr gracious lady ? 

Eml. 



1 



The^i NT E rV Ta til 305 

Emil. As ivdis as one fo great and fo forlorn 
May hold togedier ^ On her frights and griefs, 
(Which never tender lady hath borne greater,) 
She is fomething before her time, delivered. 

Paul. A boy? 

Emil. A daughter, and a goodly babe, 
Lufty, and like to live: the Queen receives 
Much comfort in*t : lays. My poor prilbner, 
I'm innocent as yon. 

Paul. I dare be fworn : 
Thcfe dangerous, unfafe lunes i'th* King! befhrew then^ 
He muft be told on't, and he (halt ; the oiEce ' 
Becomes a woman b^. Fll uke'c upon me. 
If I prove honey-mouth, let my tongue blifter j 
And never to my red-look*d anger be 
The trumpet any more ! Pray you, Emilia^ 
Commend my bed obedience to the Queen, 
If (he dares truft me with her little babe, 
ril Ihew't the King, and undertake to be 
Her advocate to th* loud'ft. We do not know. 
How he may foften at the fight o*ch* child ; 
The filence often of pure innocence 
Perfuades, when fpeaking fails. 

Etnil. Molt worthy Madam, 
Your honour and vour goodnefi is fo evident. 
That your free undertaking cannot miis 
A thriving iflue : there is no lady living 
So meet tor this great errand, rleafe your ladylhtp 
To vifit the next room, PU preiently 
Acquaint the Queen of your moft noble of&r, 
Who but to day hammered of this defign ; 
Bat durft not tempt a minifter of honour/ 
Left flie fliould be deny*d. 
PauL Tell her, Emilia^ 
I'll ufe that tongue I have ; if wit How from*t. 
As botdnefs from my bofom, let't not be doubted 
I fliall do good. 

Vol. III. X Emil. 



3o6 the WiNTBuV Tale. 

Emil. Now be you bkft for k! 
I'll to the Queen : pleafe you^ oome ibimthiiig neaitr. 

Goa. Madam, if' t plem the Q?een to fend the babe, 
I know not what I ftall iocuri to pafi it^ 
Having no warrant. 

Paul, You need not fear it. Sir ; 
The child was prilbner to the wondi, and ^ 
By law and procefi of great nature thence 
Free'd and enfranchised ; not a party to 
The anger of the King, nor guilty of. 
If any be, the trefpafs of the Queen. 

Goa. I do believe it. 

Paul. Do not you fear -, upon mine honour, I 
Will ftand 'twixt you and danger. [^ExwnU 

SCENE IV. 
Changes to the Palace. 

Enter Leontes, AntigQnus, Loris and other jStteniMi. 

Leo. ^^r O R nisht, nor day, no reft \ -~- it is but 

JJN wcakncfs 
To bear the matter thus i meer weaknels, if 
The caufe were not in being *, part o'th* caule> 
She, the adultreis; for the riarlot-King 
Is quite beyond mine arm ; out of the blank 
And level of my brain •, plot-proof; but (he 
I can hook to me : fay, that (he were gone. 
Given to the fire, a moiety of my reft 
Might come to me again. Who's there ? 

Enter an Attendant. 

m 

Atten. "My Lord. 
Leo. How do's the boy ? 
Atten. He took good reft to night ; 'tis hop'd. 
His ficknefs is diicharg'd. 

^L». 



^ 



Titf WlMTIK./ TilrE. 307 

* • 

Jjt9. 1*6 WC htt MDMIIfftf 

Conceiving the difhonour of bin tnotfier. 
He fbraight declin'd, drooped* took it deeply % 
Fafien'd, and fixM the fiuime on% !n himfelf 1 
Threw off his fptrit, his aj^ite, his flccp. 
And down*right Ianguilh*d« Leave me folelys go^ 

[_Exit yfifendants 
Sec how he fares. — Fie, fie, no thought of him 5 -r 
The very thought of my revenges that way 
RecoyI upon me ; in himfelf too mighty. 
And in his parties, his alliance ; let him be. 
Until a time may fcrve. For prelent vengeance. 
Take it on her. CamHh and Pelixenes 
Laugh at me \ make their paftime at my ibrrow ; 
They Ihould not laugh, if I could reach them ; nor 
Shall (ke, within my power. 

3 . C E.N E V. 

EnUr Pauiiiia^ ^b a CbSd^ 

Lord. You muft not enter. 

Paul. Nay rather, good my lords, be fecond to me^ 
Fear you his tyrannous paflion more, alas, 
Than the Queen's life ? a gracious innocent foul. 
More free than. he is jealous. 

Ant. That's enough. 

Jiten. [wiibin.^ Madam, he hath pot flept to night 
commanded. 
None fhould come at him. 

PauL Not fo hot, good Sir ; 
I come to bring him fleep. *Tis fuch as you. 
That creep like' Ihadows by him, and do iigh 
At each his neediefs heavings ; fuch as you 
Nourifh the caule of his awaking. I 
Do come with words, as medicinal, as true ; 

X 2 Honcft, 






308 



Tie Winter** Talb. 



!lMil • «♦ 



f Honeft, as either ; to purge faim of that fe 
That preffis him from deep. 

Leo. What noife there, bo ? 

Paul. No noile, my Lord, but needful conference 
About fome goflips for your Highnefi. 

Leo. How? 
Away with that audacious lady.— — ^%0«tfx, 
I charg'd thee, that (he (hould not con>e about me \ 
I knew, ihe would. 

jtnL I told her fo, m^ Lord, 
On your difpleafure's peril and on mine. 
She (hould not viiit you. 

Leo. VJ hat ? can*ll not rule her ? 

Paul. From all difhonefty he can \ in this, 
(Unlefs he take the courfe that you have done» 
Commie me, for committing honour,) truft it. 
He (hall not rule me. 

jlni. Lo-you now, you hear, 
When (he will take the rein, Ilet her run. 
But (he*ll not (tumble. 

Paul. Good my Liege, I come— 
And I befcech you, hear nie, who profe(s 
Myfelf your loyal fcrvant, your phyfician. 
Your moft obedient counfellor : yet that dares 
Lefs appear (b, in comforting your evils. 
Than fuch as moft feems yours. I lay, I come 
From your good Queen. 

Leo. Good Queen ? 

Paul. Good Queen, my Lord, 
Good Queen, I lay, good Queen ; 
^ And would by combat make her good, fo were I 

A 

3 Hontft, as tither ; ] i'. / whofe Aibjed it the Qgcen^i in- 
nocence: otherwjTe there would be a taatology. 

4 Jnd <iv9uld hy combat make her gc^i^ fy wsn I 

A man^ thi ivorft nheut youJ] Paulina fuppofes the KiDg*8 
jeateufy to be raifcd and inflamed by the coortien about him 1 who, 
ihe finely iays, 

critf 



The WinterV Tali; 309 

A man, on th' worft abont you. 

Leo. Force her hence. 

Paul. Let him, that makes but trifles of his eyes, 
Firft hand me: on mine own accord, PJl offi 
But firft, ril do my errand. The good Queen, 
For (he is good, hath brought you forth a daughter.^ 
Here 'tis i commends it to your blefling. 

[ Laying down the cbiU^ 

Leo. Out! 
A mankind witch! hence with her, out o'door: 
A moft intelligencing bawd! 

Paul. Not lo ; 
I am as ignorant in That, as you 
In fo intit'ling me *, and no lefs honeft 
Than you are mad ; which is enough, ril warrant. 
As this world goes, to pafs for honeft. 

Leo. Traitors! 
Will you not pufh her out? give her the baftard. 

\^Q Antigonus. 
Thou dotard, thou art woman-tyr'd ; unroofted 
By thy dame Partlet here. Take up the baftard^ 
Takc*t up, I fay ; give*t to thy croan. 

Paul, For ever 
Unvenerable be thy hands, if thou 
Takc'ft up the Princefs, by that ' forced bafenefs 
Which he has put upon*t ! 

Leo. He dreads his wife. 

«•— eriep Ukejbmda<i»$ ly himf mnd d%J^h 

At each bis midiifi hia'vittgs : — 
Surely then, ftie coold not {ay» thkc were ihe a man, the vowrfi •/* 
thefe^ (he woald vindicate her midrefs^s honoar againft the King^s 
fuipictonsy in fiogle combat ShakeJ^eart I am perfuaded, wrote, 
■ ■ ' — fi nvert I 

A man^ o n t h* w^rfi about pm* 

i. #. were I a man» I woaid vindicate her honour, on the worft of 
thefa fycophants that are about you. 

5 — — — forced ba/ene/s] farted for onnatoral. 

X 3 PmU 



3IO The WiVTiEiCs TAifit 

Paul. So, I would, you did : then 'twere paft all 
doubt. 
You'd call your children yours. 

Leo. A neft of traytors ! 

jlnt. I am none, by this good light. 

Paul. Nor I; nor. any 
But one, that^s here ; and that's himfelf. For he 
The facred honour of himfelf, his Queen's, 
His hopeful fon's, his babe's, betrays to flander, 
Whofe fting is {harper than the fword's, and will not 
(For as the qife now ftands, it is a curie 
He cannot be compell'd to't) once renx>v6 
The root of his opinion, which is rotten. 
As ever oak or ftone was found. 

Leo. A callat 
Of boundleis tongue, who late hath beat her husband. 
And now baits me ! — This brat is none of mine; 
It is the ifloe of Pdixenes. 
Hence with it, and together with the dam» 
Commit them to the fire. 

Paul. It is yours $ 
And, might we lay th' old proverb to your charge. 
So like you, 'tis the worfe. Behold, my lords, 
Akho' trie print be little, the whole matter 
And copy of the father ; eye, noie, lip. 
The trick of 's frown, his forehead, nay, the valley. 
The pretty dimples of his chin, and cheek, his fmileSy 
The very mould and frame of hand, nail, finger. 
And thou, gpod Goddefs Nature, which haft noade it 
So like to him that got it, if thou haft 
The ordering of the mind too, 'mongft all colours 
No yellow in't ; left (he fufpcft, as he does. 
Her children not her husband's. 

Leo. A grofs hag ! 
And, lozel, thou art worthy to be hang'd* 
That wilt not ftay her tongue. 
/int. Hang all the husbands. 

That 



2l&tf Winter*/ Talb. jie 

That cannot do that feat, you'll leave yourfelf 
Hardly one fubjed. 

Leo. Once more, take her hence. 

Paul. A moft unworthy and unnatural lord 
Can do no more. 

Leo. ril ha* thee burnt. 

Paut. I care not ; 
It i$ an heretkk that jnakes the fire. 
Not (be which burns in't. Til not call you tyrant. 
But this moft cruel uiage of your Queen 
(Not able to produce more accufation 
Than your own weak-hing'd fancy) fomething favours 
Of tyranny ; and will ignoble make you. 
Yea, fcandalous to the world. 

Leo. On your allegiance. 
Out of the chamber with her. Were I a tyrant. 
Where were her life ? (he durft not call mc fo. 
If (he did know me one. Away with her. 

Paul. I pray you, do not pufli me, Til be gone. 
Look to your Ixioe, my lord, *tis yours ; Jove fend hef 
A better guiding fpirit ! What need thefe hands } 
You, that are thus fo tender o*er his follies. 
Will never do him good, not one of you. ^ 
So, fo: farewel, we are gone. {Exit. 

S C E N E VI. 

Leo. Thou, traitor, haft let on thy wife to this. 
My child ? away with^t. Even thou, thou that haft 
A heart fb tender o*er it, take it hence. 
And fee it inftantly confum^d with fire*, 
Even thou, and none but thou. Take it up ftraight : 
Within this hour bring mc word it is done. 
And by good teftimony, or Til feize thy life. 
With what thou elfc call'ft thine: if thou refule. 
And wilt encounter with my wrath, fay fo : 
The baftard brains with thefe my proper hands 

X 4 ShaU 



314 3lSv WinterV Taie, 

Shall I daQi out : go take it to the fire, 
For thou fctt'ft on thy wife. 

Ant. I did not, Sir: 
Thefe lords, my noble fellows, if they pleale, 
Can clear me in't- 

Lord. We can ; my royal Liege, 
He is not guilty of her coming hither : 

Leo. You're h'ars all. 

Lordf.^^ktcYi your Highnefs, give us better credit. 
We've always truly ferv'd you, and befeech you 
So to efteem of us : and on our knees we bqg, 
(As recompence of our dear fervices 
Paft, and to come) that you do change this purpofe. 
Which being fo horrible, fo bloody, muft 
Lead on to fome foul iiTue. We all kneel ~— 

Leo. I am a feather for each wind that blows : 
Shall I live on, to fee this baftard kneel 
And call me father ? better burn it now. 
Than curfe it then. But be it ; let it live : 
If fhall tipt neither, — You, Sir, come you hither ; 

[To Antigonus« 
You, that have been lb tenderly officious 
With lady M^rgery^ your midwife there, 
Tp fave this baftard's life ; (for 'tis a baftard, 
3o fure as this beard's grey) what will you adventure 
To fave this brat's life T 

Ant. Any thing, my Ix>rd, 
That my ability may undergo. 
And nobleneis impoie : at leaft, thus much ( 
1*11 pawn the little blood which I have left» 
To lave the innocent ; any thing poifible. 

JLeo. It ihall be poffible ; fwe^ by this fword. 
Thou wilt perform my bidding. 

Ant. I will, my Ijord, 

L^. Mark and perform it \ feeft thou ? for the fail 
Of any point in't mall not only be 
pp^th to thyfelf^ but (o thy lewd-tongu'd wife. 

Whom 



The WinTerV Tale. 31^ 

Whom for this cime we ptrdon. We enjoy d theeg 
As thou art liege-man to us^ that thou carry 
This female baftard hence, and that thou heat it 
To fome remote and defart place, quite out 
Of our dominions *, and that there thou kave it, 
(Without more mercy,) to its own proteftion 
And favour of the climate. As by ftrange fortune 
It came to us, I do in juftice charge thee. 
On thy foul's peril and thy body's torture^ 
Thac thou commend it ftrangely to fbme place^ 
Where chance may nurfe, or end it. Take it up. 

jlffl. I fw ear to do this : tho' a prefent death 
Had been more merciful. Come on, poor babe 1 
Some powerful fpirit inftruft the kites and ravens 
To be thy nurfes ! Wolves and bears, they lay, 
(Cafting their favagenefs afide) have done 
Like offices of pity. Sir, be profperous 
In more than this deed does reouire ; and bleflingt 
Againft this cruelty, fight on tny fide ! 
Poor thing condemned to lo& ■ ^ 

[£xi/, with the cbild^ 

Leo. No ; Pll not rear 
Another's ifliie. 

Enter a Meffhger. 

Mef. Pleafe your Highnels, pofts. 
From thofe you font to th* oracle, are come 
An hour fince. Cleomines and Dim^ 
Being well arrived from Delpbos^ are both landed, 
Haftine to th' court. 

Lord. So pleafe you, Sir, their fpeed 
Hath been beyond account. 

Leo. Twenty-three days 
They have been abfent : this good fpeed foretels, 
The great Jpolh fuddenly will have 
The truth of this appear. Prepare you, lords» 
Summon a feflion, that we may arraign 

Our 



|t4 7^ Winter'/ Talb* 

Our m^ difiofri Lady ; for as fhe hath 

Been pubNddy ftGCiis*d» fo fliatt (he hare 

A jud and open cryal. While (he lives. 

My heart will be a burthen to me. Leave me. 

And thtnk upon my Inddii^. {^Exeunt feveralhf. 



A C T III. SCENE I. 

A Part qfS^y^ near the Sea-fide . 
Enter Qeooiines ani Dion. 

C L BOM IN BS. 

TH E clhnate^s delicate, the air mofl fweet, 
' Fertile the ifle, the temple much furpaiCng 
The cominon praife it bears. 
Dion. * It (names report 
Foremoft it caught me, the cele((ial habits, 
(B4ethinks, I fo fliould term them,) and the reverence 

f TertiU the iflc . } Bat tke temple of ApolU at Delphi was 

not in an ifland, but in Plnds^ on the continent. Either Sbd^^ 
fiear^ or his Editors, had their heads ranning on D/A/, an ifland 
of the CytkJis. If it was the Editor's blunder, then Shmh/pe^ 
wrote, Fertile the foil, ' 

which is more elegant too« than the prefent reading. 

2 I SHALL report, 

Foa MOST it caught me, kcJ\ What will he report? And 
what means thb reafon of his report, that the celeilial iiabiu moft 
Crack his obfervation ? We ihould read. 

It shames report. 

Fo HE MOST it caaght me, 

Cbemines had juft before iaid, that the Temple mmeh furpaffed thi 
eemmett praije it here. The other, very naturally, replies — it 
Jhamef report, as far furpafling what report faid of it. He then goes 
m to particularize the wondm of the place : Feremoft, or firs of 
all, the priefts garments, then their behanoar, their aft of facri- 
fioe, fie. in rewnable good order. 

Of 



The WlNTinV TAht. 115 

Of the ff^Yt wearers. O, die fiicrifice—- ^« 
How ceremonious, folema, ud unearthly 
It was i*th* ofiering ! 

Cleo. But of all, the burft 
And the ear-deafning voke o'th' oracle. 
Kin to Jove^s thunder, fo furprizM my fenfe. 
That 1 was nodiing. 

Dm. If th* event o'th* journey 
Prove as fuccelsful to the QiioeD, (O b^t (b f) 
As it hath been to us, rare, plealant, fpeedy^ 

^ The uie is worth the time OB^t. 
Cl^o. Great ^/b. 

Turn all to th' beft ! theft proclamations. 

So forcing faults upon Hermkme^ 

I little like. 

Didn. The violent carriage of it 

Will dear, or end the bufinefi % when the orack» 

(Thus by jfpotWn great divine feal'd up,) 

Shall the contents diicover : ibmething rare 

Even then will rufli to knowledge. Go i frefli horfin : 

And gracious be the iflue! [Exeuntm 

SCENE II. 
Reprejents a Court of JujHce^ 

Leontes, Lords and Officers^ appear pr^perljf fiMUd. 

Leo. TT HIS feffion, (to our great grief, we pro» 

1 nounce,) 

Ev^n puflies 'gainft our heart. The party try*d, 
The daughter of a King, our wife, and one 
Of us too much beloved ; — ^let us be cleared 
Of being tyrannous, fince we fo openly 

3 fbi time is nuTtb thi afe m*/.] It Ihoold be jufl; the rever&y 
nt afe it w^tb thi time #»V. 
Bitd this alteration tbe Os^rd Editor appravoB. 

Pro- 



3i6 23&tf WintbrV Taljb. 

Proceed in juftice, which fball have due courle. 
Even to the guilt, or the purgation. 
Bnoduce the prifoner. — 

Offi. It is his Highnefs* pleafure, that thi^ Queen 
Appear in perfon here in court. Silence ! 

Hermione f j brought in^ guarded ; Paulina^ and Ladies 

atffndifig. 

Leo. Read the indidment. 

Cffi. Hermione, ^en to tie worthy Leontes, Brg 
^Sicilia, thou art here accufed and arraigned ofb^b 
treafon^ in committing adultery with Polixcnes, Kit^ 
of Bohemia^ and conjpiring with Camillo to take away 
the life of our foverrign lord the IGng^ thy royal buf 
hand ; the pretence whereof being by circumjlances partly 
laid open^ tboUf Hermione, contrary to the faith and 
aO^giance of a true Jubjeff^ didft counfel and aid them^ 
for their better fafety^ tofiyaway by mght. 

Her. Since what I am to fiiy, muft be but That 
Which contradids my accufation ; and 
The ceftimony on my part, no other 
But what comes from mylelf ; it fhall fcarce boot me 
To (ay. Not guilty : mine integrity. 
Being counted falfhood, (hall, as I exprefi it, 
Be fo received. But thus, if powers divihe 
Behold our human adions, as they do, 
I doubt not then, but innocence (hall make 
Falfe accufation blulh, ** and tyranny 
** Tremble at patience. — You, my Lord, beft know. 
Who leail will ieem to do lb, niv pad life 
Hath been as continent, as chalte, as true. 
As I am now unhappy ; which is more 
Than hiftory can pattern, tho' devis'd. 
And play*d, to talce fpcAators. For behold me 
A fellow of tiM royal bed, which oWie 
A moiety of the throne, a great King's daughter. 
The mother to a hopeful Prince, here Handing 

To 



._ I 



The Winter'* TAtE« 317 

To prate and talk for life and hooour^ *fore 

Who pleafe to Cowt and hear. For life, I prize ic 

As I weigh gf ief which I would fpare : for honour, 

*Tia a derivative from wt to mine. 

And only That I (land for. I appeal 

To your own confcience. Sir, before PoSxims 

Came to your court, how I was in your grace* 

How merited fo be fo ^ fince he came. 

With what encounter fo uncurrenc I 

Have ftrainM ('appear thus i if one jot beyond 

The bounds of honour, or in a&, or will 

That way inclining, hardned be the hearts 

Of all that hear me, and my near*ft of kin 

Cry, 6e, upop my grave ! 

Leo. I ne'er beard vcty 
That any of chofe. bolder vices wanted 
Lefs impudence to g^in-fay what they did. 
Than to perform it firft. 

Her. That's true enough ; 
Tho' 'cis a faying. Sir, not due to mc. 

Leo. You will not own it. 

Her. More than miftrefs of. 
What comes to me in name of feult, I muft not 
At all acknowledge. For PoUxeneSy 
With whom I am accused, I do confcfs, 
] lov*d him, as in honour he^re^uir*d ; 
With fuch a kind of love, «s might become 
A lady like me ; with a love, even fuch. 
So and no other, as your feif commanded : 
Which not to have done, I chink, had been in me 
Both difobedience and ingratitude 
To you, and towards your friend ; whofe love hzi 

fpoke. 
Even fince it could fpeak, from an infant, freely. 
That it was yours. Now for Confpiracy, 
I know not how it taftes, tho* it be diui'd 
For me to try how ; all I know of it^ 



3t8 tii WiMTinV Tale* 

Is, that CamHh was m hontft man ; 

And why he ieftymir Court, the Gods tliemfelves 

(W<ittifig no more than hj are ignofant. 

Leo. You knew of his defNurture, as jmi knov 
What you have underta'tn to 4o in's AbAoce. 

Her* Sir, 
You fpeak a language that I nadarftand not; 
My lire (lands ki the level of your dreams. 
Which Pil lay down. 

Leo. Your A&ions are my Dreams. 
You had a BsAard by Polixenesj 
And I but dreamed it :«-*as you were paft all ihame, 
(Thoie of your Faft are fb) fo paft all ouch ; 
Which to deny, concerns more than avails : for as 
Thy brae hath been caft out, like to k feif. 
No father owning k, (whkh is, ifideed. 
More criminal in thee than jc) fo thou 
Shalt feel our juftice ; in whofe •eafieft pafiage 
Look for no lefs than death. 

Her. Sir, Ipape your threats $ 
The bug, which you woukl fright me with, I feek : 
To me can life be no commodky. 
The crocwn and comfort <^ m^ life, your Favour, 
I do give loft ; for I do feel it gone. 
But know not how k went. My fecond joy. 
The firft-fruits of my body, from 4^s prefence 
Fm barred like one mfe^ous. My ditrd comfort, 
(Starr'd moft unluckily,) is from my breaft 

S~^he innocent milk in its moft innocent mouth) 
al'd out to murder ^ my felf on every poft 
ProdaimM a ftrumpet with immodeft hatred ; 
The child-bed privilege deny'd, which *iongs 
To women of all faftiion : laftly, hurried 
Here fio this place, i'th* open air, before 
I have got ftrength of limit. Now, myUege, 
Tell me what bleflings I have here alive. 
That I Ihould fisir to die ? therefore proceed : 

But 



Thg WiNtBRV TALa ^19 

Bat jtt hear diii I miftite ne not 1 no h& i " ■> 
I prize it tieca firMr $ but for mine koniMr^ 
Which I ivodd tee, if I ftall bewMfaMVI 
Upon furmifes, (all proo6 fleepbg elfe. 
But what yoor jealowes awakeO 1 tell yout 
*Tis Rigour, and not Lav. Your Honours alh 
I do refer me to the Qracte : 
yipoSo be my judge. 

SCENE m. 

Enter Dion and Cleomines. 

iW. This yoar tcqucft 
Isalcc^herjoO:; therrfore bring Ibrth^ 
And in ApaUo^s name, his Oracle. 

Her. The Emperor of Ruffia was my tatfaer. 
Oh, that he were alive, and here beholding 
His daughter's tryal ; that he did but fee 
The flatncfs of my mifery 5 yet with eyes 
Of Pity, not Revenge! 

Offi. You here Ihall fwear upon the Sword of 
Jufticc, 
That you, Qeomines and Ditm^ have 
Been both at Delpbos^ and from thence have broi^hc 
This fcal'd upOfadc, by the hand ddrvcr'd 
Of great Jpollo^s Pricft ; and that fmcc then 
You have not daf^d to break the holy Seal, 
Nor read the fccrcts in't. 

Cleo. Dion. All this we fwear. 

Lea. Break up the Seals, and read. 

Offi. Hcrmionc is cb^e^ Polixcnes hUmehfs^ O- 
millo a true Subject ^ Lcontcs a jealous Tyrant^ 'tis i»* 
nocent babe truly begotten ; and the Kingjball Uvs wiib- 
mU an beir^ if Tbatj wbicb is lojlj be not founds 

Lords. Now bleffed be the great Jptdlo / 

Her. Praifcd ! 

Leo. Haft thou read truth ? 



320 lie WintbilV Tale. 

Ofjhr Ay, my lord, even £> as it is h^c iec down* 
Lgo. There is do truth at all i'th' Oracle ; 
The SeflioD fhali prooeed % this is meer faUhood. 

Enter Servanl. 

Sen My lord ihe King, the King»-— 

Leo. What is the bufineis ? 

Set. O Sir, I fliall be hated to report it. 
The Prince your Ton, with meer conceit and fear 
Of the Queen^s Speed, is gone, 

Leo. How gone i 

Ser. Is dead. 

Leo. jipollo's ang;ry, and the heavens themfelves 
Do ftrike at my injunice. — How now, there ? 

[Her. faiiits. 

Pau. This news is mortal to the C^een : look 
down. 
And fee what death is doing. 

Leo. Take her hence ; 
Her heart is but o*er-char^d ; (He will recover. 

[^ExeunS Paulina and ladies mtb Herrnxme. 

S C E N E IV. 

I have too much believed mine own fufpicion : 

*fieieech you, tenderly apply to her 

Some remedies for life. JpollOy pardon 

My great Prophanenefs 'gainft thine Oracle! 

Pll reconcile me to PoUxenes^ 

New woo my Queen, recal the good CamiUo ; 

(Whom I proclaim a man of Truth, of Mercy) 

For being tranfported by my jealoufies 

To bloody thoughts and to revenge, I chofe 

Camillo for the Minifter, to poifon 

My friend Polixenes ; which had been done. 

But that the good mind of Camillo tardied 

My fwift Command i tho* I with death| and with 

Reward, 



The WihtbrV TAif. 321 

RewfU'd) did tbreatisn) luid encourage hioi^ 
Noc doing it, and l^ng done i be (moft humane, 
And filled with Honour) to my kingly Guefl 
Unclafp'd my pra^licf, quit his fonunes here. 
Which you knew great, and to the cercain hazard 
Of ail inocrtaincics himfelf commended. 
No ricl^r than his honour : . how he gliders 
Through n>y dark Ruft ! and how hL Pictf 
Does my dieeds make the blacker ! 

SCENE V. 

Enter Paulina. 

Pau. Woe the while ! 
O, cut my lace, ^ tell: my hearr, cracking it, 
Bnrak too. . . ■' 

Lord. What fit is this, good lady ?. 

Pau. What fludied torments. Tyrant, haft for roe ? 
What wheels ? racks? fires ? what flaying ? boiling? 

burning 
In leads, or oils ? w,hat old, or newer, torture 
Muft I receive ? whoie every word defenrcs 
To tafte of thy moft worft. Thy Tyranny 
Toget^r irking wkb thy Jealoufics, 
f Fanci^ too weak for boys, too green and idle 
For girls of nine I) ,0, tiunk, whic they have done^ 
And then run mad, indeed ; ftark mad, for all 
Thy by-gone fooleries were hut fpices of it. 
That thou hctf2Ly^dA Polixenesj *cwas nothing > 
That did but ^ ihcw thee off, a fool, inconftant. 
And damnable ingratefui : nor was*t much. 
Thou would'ft have poifon*d good CamUlo's honour. 
To k^ve him kill a King : poor trefpafles, 

4 :fitw the of a fioi — ] So all the copies. We ihowld 

read, ■ \fi fe<w tbee pff, m /Sff/,— i. e. reprafcot thee in th/ 
true colours ; a fool, ao inconltan(, &*<-. 

. Vol, III* • Y More 



322 The WiN<T*R*i Tale. 

More monflrotis (binding bf ; whereof I reckon 
Tbe cafting forth to crows thy baby*daughcer» 
To be, or none, or little ; tho' a devil 
Would have flied water out of fire, ere don*c : 
Nor is'c direiftly laid to thee, the death 
Of the young Prince, whofe honourable thougfits 
(Thoughts high for one fo tender) cleft the heart. 
That could conceive a grofs and foolifh Sire 
Blemifh'd his gracious Dam : this is not, no. 
Laid to thy anfwer ; bat the laft, O lords. 
When I have faid, cry, woci the Queen, the Queen,— 
The fwoeteft, deareft, creature's dead ; and vengeance 

for't 
Not dropt down yet, 

Lor^, The higher Powers forbid ! 

Pau, I fay, (he's dead : I'll fwear^ : if word, nor 
oath. 
Prevail not, gp and fee : if you can bring 
Tinfture or luftre in her lip, her eye. 
Heat outwardly, or breath within, I'll ftrve you 
As i would do the Gods. ^ Bat, O diou^cyrinc ! 
^ Do not repent tfaefe things ; for they are heavier 
^ Than all thy woes can ftir : therefore betalce tbec 
^ To nothing but Defpair. A thoufand knees, 
*' Ten thoufand years together, naked, ^foffilng^ 
^ Upon a barren mountain, and dill winter 

* In (lornt perpetual, could not move the Gods 

* To look that way thou wert. 
: .Leo. 43o.on, goon: 

Thou canft not Jpeak too much •, I have deferv'cjl 
All tongues to talk their bitcereft. 
Lf^d. .Siiyno more \ 
- Howe'er the bufinefs goes, you have noacie f^ulc 
Tth* boldnefs of your fpeech. 

Pau. I am forry fort. 
All faults I make, when I fhall come to know tbem^ 
I do repent : alas, I've ihew'd too much 

The 



21&tf WivT'B'k'sTAtt^ 323 

The raihetfi of a woman,; faetis tduchVi: ^ 

To th' nobte iiearc. Whatf^ gone, and what's pad 

helpf 
Should be paft grief. Do not receive afflidion 
Ac my peticioia^ I beieecb you % rather 
Lec-ine bepunifh'dy that have minded you 
Of what you {hould fot^et. Now^ good my liege. 
Sir, royaJ Sir^ forgive a faoliih woman ; 
The love I bore your C^ieen — Jo, fool agiain !-— 
I'll (peak of hti no more, nor of your children : 
V\\ not remember you of my x)wn lord, . 
Who is loft coo. Take you your patience to you. 
And ril fay nothing. 

Leo. Thou didft fpeak but well, 
When moft the truth; which I receive. much better 
•Thaif 10 be pitied of thee* Pr'y thee, bring me 
To the dead bodies of my Queen and fon ; 
One Grave (hall be for both. Upon them fliali 
The caufes of their death appear unto 
Our fl)ame; perpetual ; once a day I'll viik 
The Ci^apei, whae they lye, and tears, ihed tfaere^ 
Shall bfi my iieci:eation. So long as nature 
W^ibotr vp.wkb this exercife, fo long 
I daily vow toufe it. Come, and lead me 
To dvfi^J&rrows^ . iExeunL 

»* ■ • . • . 

S C E N E VI. 

Changes to Bohemia. A dtfart Country ; the 

Sea at a link Diftance. 

Enter Antigonus wUb a CbiUj and a Mariner. 

,^/npHOU art perfeft then, our Aip hath 

X touch'd upon 

The defarts of 5^i&^ww ? 
Mar. Ay, my lord s and fear, 

Y z We>e 



32+ Th WiHttnV Tkti\ 

We've landed in ill time : the skies lo6k gtiitil^. 
And threaten prcfent btuffers; In my codfcience^ 
The heavens with that we have in hand are angry » 
And frown upon's. 

Jnt. Their facred wilts be done ! get thee aboard. 
Look to thy bsrk, IMl not be long before 
I call upon thee. 

Mar. Make your beft hade, and go not 
Too far i'th' land ; 'tis Kke to be loud Wcariict. 
BefideS) this place is famous for tht creatures 
Of prey, that keep upon*t. 

jfn$. Go thou away. 
PU follow inftantly. 

Mar. Pm glad at heart 
To- be fo fid o' th' buCnefi. [£«». 

Jnt. Come, poor babe ; 
I have heard, but not believed, the fpirirs oFdkedeali 
May walk again % if fuch thing be, tliy motbcir 
Appeared to me laft night ; for ne'er was dream 
So like a wakiftg. To me comes a creaturei * - 
Soitoetimes her head on one fide, Ibme another, 
I never faw a veflcl of like forrow 
So filled, and fo becoming ; in pure whter rcAds, 
Like very fan£Hty, fhedid approach * 
My cabin where I lay ; thrice bow'd befbm me,' 
And, gaf^ng to b^in fome fpeech, her eyes 
Became two fpouts ; the fury fpent, anon 
Did this* break from her. Good Antigonusy 
Since fate, againft thy better difpofition, 
Hath made thy pcrfon for the thrower-out 
'Of my poor babe, accordmg to thine oath, 
Flaties remote enough are 4n j?0£7^mi^, 
There weep, and leave it crying; and , for the babe 
Is counted loft for ever and ever, Perdita\ 
I pr'ythce, call't. For this ungentle bufinefe. 
Put on thee by my lord, thou ne'er (halt fee 
Thy wife Paulina more.' And fo, With ihricks. 

She 



The X^^interViTa^.^* 325 

She tnelfied ioCQ air. Ai&igbted much, 

I did in tiine coUed myfelf, and thought 

^ This was bh and no fluinU)er : Dreaois are toys^ 

Yet for this once, yea, fuperdicioufly, 

I will i)e %iar'd by this. I do believe^ 

Hermone hach fuf&r'd death ; and thac 

Apollo would, this being indeed the iflbe 

Of King Polixenes^ it ihould here be laid, 

Eith^ for lii'e or death, xjngon the earth 

Of its rig^ father. Bloflaxn, fpeed thee well ! 

[ Laj^t^g down the cbild^ 
There Jye, and there thy chara&er ; there tbefe. 
Which may, if Ibrtune pleafe, both t^recdth^, pretty 

one. 
And fUlI reft thine. The dorm (begins. \ t~— Poor 

wretch. 
That for thy mother's fault art thus expofi'd 
To lofs, and what may follow, (weep I .ca^pot^^ 
But my heart bleeds : and moft accurft am | 
To be by oath enjoin'd to this.) Farewel ! 
The day frowns more and more \ thou art like itx 

have 
A lullaby too rough : I never faw 
The heav'ns fo dim by day. A favage plamour! 
Well may I get aboard ! this is the chace } 
I am gone for ever. [£^^^ furfued by a tear. 

SCENE VJL 

Enter an old Shepherd. 

Sbep. " I would there were no age between ten ai^d 
•* three and twenty, or that youth would fleep out 
" the reft : for there is nothing in thQ^between but 
" getting wenches with child, wronging the ancientry, 

5 Tlfij nvas fO, 1 I rather think Sbakefiear wrote sooth^ 

i.tf. a truth, a reality. 

Y 3 ** ftcaling, 



326 The WinterV Tali. 

*' ftealingt fighting ■ > 1 hark you now t -~ wouH 
<< any but thefe boil'd brains of nineteen, and two 
*' and twenty, hunt this weather? They have icarM 
«< away two of my bed ihcep, which, I fcar^ the 
'* wolf will fooner find than the nuiAer ^ if any whei« 
*' I have them, *ti$ by the fea-fide, brou^tng of ivy. 
*^ Good luck, an*t be thy will ! what have we here i 
*• [Xaking up the Md.'] Mcfcy orfs, a beamc! a very 
*^ pretty beame ! a boy^ or a chikl, I wonder! a pret- 
** ty one^ a very pretty one ; fure, fome '{cape : tho* 
^^ I am not booicifli, yet I can read waiting-^gentlcwo- 
" man in the *fcape. This- has been fome flair-work, 
f^ fome truak«>work, fome behind-door-work :" they 
were warmer that got this, than the poor thing is hare 
I'll take it ^p for pity, y^ TH tarry 'till my fdn come : 
he l|Ollow*d but even now ^ Whoa, ho-'hoa I 

Softer Clown. 

Ch. HiHoa, loaf / ' 

Sbep. What, art fo near ? if thou*It fee 4 tiling to 
talk on when thou art dead and rotten, come hither. 
What airft thou, man ? 

Clo. I have feen two fuch fights, by fiSi ahtj by land ; 
bat I am nor to fay, it is a fea *, for it is rib W tne sky ; 
betwixt the firmament and it you cannot thrq.fl: a bod- 
kin's point^. "'. » 

Sbep. Why, boy, how is it? • 

Clo. " I would, you did but fee how it chales, how it 
>• rages^ how it takes up the fhore ; brt that*s not to 
•^ the point •, oh, the moft piteoiis cry of the poor 
^* fouls, fometimes to fte 'em, and not to ftc 'cm : 
" now the fhip boring the moon with her main-maft, 
. *' and anon fwallow'd with yeft and froth, as yoa*d 

** thmft a cork into a hogfliead. ^ And then for the 

... • ' 'I 

6 An J then fir the land fir'vtct^'\ Every one feps tbe humoor 
of this military expreflion of land-fer^vhe \ and how wdl ic is 
adapted to tbt citareAer. Yet' t&e Qxfiri £ditor alters it to A»/- 

« Ian4 



3&f Wi N T jj kV T^ a l b^ 32 7 

** hficWcrviar— *to fee fcew- the bear tore out his 
** ihQQUer4)Qirie^ how lie cry 'd t» me for help, and 
^ laid, ^his ftatne was AfiPigonus^ a nobteman. But to 
*• niafee tnehd of theihip, to fee how the fca flap- 
** dragpn^d it. But firft, how the poor fouls roar'd, 
** and tbe &a mock'd them. And how the poor gen- 
*^ tieman roar'd, and the bear mock'd him 5 both 
^ roaring louder than the iea, or weather. 

Ship. 'Name of mercy, when was this, boy ? 
Qo. Now, now, I have not wink'd fince f law thefc 
fights ; the men are not yet cold underwater, nor the 
bear half din'd on the gentleman ; he's at it new. 
^ Ship. 'Would, I had been by to have hdpM the 
cAd man. '^ ' 

Clo. I would, you had been by the Ihip-fide, to have 
helped her 1 there your charity would have lack'd foot- 
ing.— — [Afide. 
Sbep. Heavy matters, heavy matters ! but 3ook thee 
here, boy. Now bkfsthyfelfj thou meet*ft with things 
dyingi I with things new [)om. Here's a fight for thee ; 
look thee, a bearing-cloth for a fquire*3 child'^ look thee 
here -, cake up, take up, boy, open't \ fo, let's fee : it 
was toici me, I fhould be rich by the fairies. This, is 
ibme chaogling : open't ; what's within, boy ? 

Qo. You're a mad old man ; if the fins of your 
youth are forgiven you, . you're well to live. Gold ! 
all gold J- 

^bep. This is fairy gold, boy, and will prove la. 
Up with jt, keep it clofc : home, home, the next way. 
We are lucky, boy ; and to be fo ftilU requires no- 
thing but fccrcfic. Let my Iheep go : coioe^ good 
boy, the next way home, 

Clo, Go you the next way with your findings^ I'll 
go fee if the Bear be gone from the gentleman ; and 
how much he hath eaten : they arc never curft but 
when they are huqgry : if there be any of him left, 
ril bury it. 

Y 4 Ship. 



32S The WlHTEK'S Talc« 

Sbep. Tliaf s a good deed If tkes mtf& ^kkrtt 
by chac ^hich is left of him, wJiat be «s> ^^ih me to 
cb' fight of him. « 

Clo. Marry, will X \ and you iball hdp n pot hkU 
i*ch' ground. 

Sbep. 'Tis a lucky day, boy, and mtfH do good 
deeds on't. {Bmmftii 

Enter Time, as Qforus. 

Time. I, that pleaie fome, try all> both joy amd 
terror 
Of good and bad, chat make and unfold error i 
Now Cake upon me, in the nameof STiuw^,^ 
To uie my wings. Impute it not a crime 
Xo me^ or my fwift paflage, that 1 Aide 
O'er fixtecn years, ^ and leave the gulf untry*d 
Of that wide gap ; fince it is in my power. . 
To overthrow law, and in one fclf-born hoar 
To plant and overwhelm cuftom. Let me {>afi 
The fame I am, ere ancient'ft order wa$^ 
Or what is now received. I witnefs to 
The times, that brought them in , fo Ihall I do 
To th' freflieft things now reining, and make dale 
The gliftering of this preient, as my tale 
Kdw feems to it : your patience this allowing, 
J turn my glafs ; and give my fcene fuch ^rowmg» • 
As you had flcpt between. Leontes leaving 
Th* effefts of his fond jealoufics, fo grieving 
That he fhucs up himfclf ; inaagine me. 
Gentle fpedators, that I now may be 

7 •— ^— an J leave the gkowth untr^i 
OfttatwJegafi-^-^ i he growth of what ? The reading 
is noDfenfe.' Shake/fear wrote 

and lea've the rulf vntryd, x. /. unwaded thro\ By 

.All 



this meaoi, too» the uniformicy of the metaphor is reAored 
the terms of the fentence, Hciaung to a Cuifi ^/wift faji^e^ 
jliie ever — ^ MrfryV— - wiV/^ ga^* 



In 



r*r. WJ n t^^V, T^M Mil $^ 

I xnocicn We a ibn^A'JKiog's*wfaQjm ^vMiMT: i^ 
I now nane to jom $ and with ipood faffm< ^ 
ToifSik.iali' P^d^at nowgrowo u graa. - • 
Equfti with wondring. What of her enfiK^ 
I Ukaat jifoftiidbs. But kc TiouAfr aew$ 
Be^lmdwa, whtn 'cis broi^c forth. A ftqited^ 

daughter, 
And what to her a(flierei, which fcdlows afcei;» 
fa th' JB^trmeoc of cknc^ «f tim aAlair, 
If ever joa have ipeat time worfe ere n&p i 
If nearer, yet chat 9%i^ bimfetf doch %v~ ' 
He wiflies otmdt^y, yootiMtr imy; ^ ^ £J^; 

1- ' • .7/ 






rf^ 



7 



ACT IV. 3; C E IsTfe t 



Sr)6r Churt of Bohaoiia* ^ 

• 

' Ertier Polixencs ^i Camifio. 



Pot rXBNft^. 



- «" . ! 



• ■ • » 



IPray i:hce, good CamiUoy be no more importunate ; 
'tis a fickn^^ deoyiog thfse a^^.ti^i^^ >4c^ to* 
grant this. ; . «^. 

Ctfm. It is fifteen yea^rs fince I faw oayjcountry^ 
though I have for the ,nK>&^ part been aired abroad, \ , 
defire to lay my bones there, fiefides, the penitent * 
King, my mafter, bath ieatfoF me^ 19 whcficieeUng 
forrows I might be fome allay, or I o-crwcen to think 
fo, which is another fpur to my dtJpartwltr. 

Pol, As thou lov'ft me, CamiUo^ wipe pot oiit the 
reil of thy fer vices by leavitaig me now y .the imd I 
have of tbee^ thine own goodne^ haihmade: better 

not 



330 ^ Winter*/ TAl^; 

not to baive had thee, than thus to mfot ;difie« Thoa 
havina^tnade me bufineffcs, which ii{»ie> without thor^ 
can (umck»idy manage, muft either Aaf co-execuee 
them thy (elf« or take away with thee the yeiy :&nriees 
thou haft done } which if I have not eooi%h coiifi- 
der*d, (as coo much I camot,) to be^more thaoklid 
to thee iball be my ftudy i ' and my profit tkecBb* 
the reaping friendfliips. Of that fatal country Sidha^ 
pr*ythee» ipcak no more ; whofe very nanaing pu- 
nilhes me with the; rccoeR^Qce; of that, penitent^, s^ 
thou calj'ft him, and .reconciled King my brodwfv 
wholq l^s of his moA; precious Qieea aod children am 
eyen.i^w lo be afivih lamented*, Say to me* wihcfi 
faw'ft th0U the Prince Fhrml my fon I Ktng3 are «o 
le& QAha];^y» their ifliie nofiherag gitdoui, than jthc^. 
are in lofing them, when they have approved cbeir 
virtues. . . 

Qam. Sb-, it is three days fince I faw the Prt!ice ; 
what his happier afiairs may be, are to me unknown : 
* but I have (miffing him) noted, he is of late much re- 
tired from court, and is lefs frequent to his princely 
exercifes than formerly he hath appeared. 

PoL I have confidcr'd fo much, Catniltoj and with 
feme care fo far, that I have eyes. under my fervicc, 

which look upon his removednefs) from whom 1 

* t* 

fenfe. We $ioaki read, r^sapimq frim4/bips. 1 he KSftg liad 
iaid his |lttdy ihauld be to xewani his fri«nd*6 deiisrci i and then 
concludes, that his profit in this fludy ihould be reafimg the 
firuits of his frieiid*s attachment to him ; which refers to wba^ he 
had before iaid of the necefiity of Camilio^ tsAjf or othemfife he 
cotild aot fcap the tmt of thoTe bujmtffis, which Camifb hfA 
cut out. 

^ hmi I bmii (m,is8Ii»gly)'m/#^,] We fliould read, hmi Ibm^ 
(missino him) mtei. This accounts for the reafon of fai$ 
taking note, faecaafehe often miiled him, that is, wanted his ancea- 
ble company. ^^ a compliment is intended ; and, in that fenft^ 
i: is to be onderftood. lYs^Oxfiti Editor x^s, mujinglf mltd, 

have 



The WinterV Tale. 331 

have this intelligence, that he is feldom from the houfe 
of a moft homdy fliepherd ; a man, they fay, that 
from rery nothing, and beyond the imagination of 
iiis neighfooiirst is grown into an unfpeakable eftate. 

Cam. I bare heard, Sh*, of fuch a man, who hath 
a daaghter of moft rare note ; the report of her is ex* 
tended more than can be thought to begin from fuch 
aoottage. 

Pol. That's likewife a part of my intelh*gence 5 but, 
I fear, the Angle that plucks our fon thither. Thou 
flnk accompany us to the place, where we will (not 
appearing what we are) have (bme queftion with the 
fliepherd ; firom whofe fimplicity, I think it not un« 
cafic to get the caufc of my fon*s refort thither. IVy- 
thee, be my prefent partner in this bufinefs, and hj 
afide the thoi^hts of Sicilia, 

Cam. I willingly obey your command. 

PoL My beft CantUlo — we muft difguife outfthres, 

[^Exeunt. 

SCENE IL 

CJhanges to the Country. 

Enter Autolicus ftr^ng<> 

WHEN daffodils begin to peere^ 
Witb^ be^b! the dotsy wet th&dde^ : 
^Wb% then come in tbejiveei o^Uf year ; 

*Fore the red Mood reins-in the winter ]pali, v 

3 ff^ht '^'» COMES gn ibef'weet ^ tFjeari. 

* Tor the red blood rbions //r the wintc R.*S /^4^-} X lliink 
this noDfenfe fhould be read thus, . ^ 

Wby^ then come in the faueei oUP jear ;^^ 

*Fo R B the red Blood R E i N s-i« /be <u;iBiirtati^ 

/. /. Why then come in, or let us enjoy, pleafure, while the feafoa 
lenre$» before pale nninter^ reins-im the rid or youthful bbodi m 
much as to iay, let us enjoy life in ^youtb, beme old agp comes 
and fi^eezes op the blood. 

The 



332 



The Winter*/ Tale. 

5tte vfhUeJbitt kleacking on ike hedge i 

Witb^ b^y ! tbejweH birds , hew ibeyjitig f 
Votbfit nvf (d)frcgging ioalb on tdge: 

For a quart ^ ale is a Ajhfor a king, 
fhelark^ that tirralyra cbatUSy 

ff^ttby bey / wUb^ bey ! tbe tbrujh and ibejay z 
Am fiimmer fongs for me and my aunts 9 

IVbile we lie tumbling in the bay. 

I have fcrved Prince Florizel^ and in my time wore 
three-pile, but now I am out of Service. 

Bi^t fifdl I go mourn for tbat^ my 4^r? 

Tf^e pale moonjhines by night : 
/fttd when I wander here and tbere^ 

I then do go moji right. 
If tinkers may have leave to Uve^ 

And bear tbe f/mi^kin b fidget ; 
^iesi my account I well may grve^ 

And in tbejiocks avouch it. 

My trafHck is {heets ; when the kite, buili^s, look to 
leflcr linnen. ^ My father nam'd me Autolicus^ 
being litter'd xsvA^M^cury % who, as i am, was like- 
wife a fnapper*up of unconfider'd trifles : with die and 
drab» I purcbasV) this capariibn ; and ^ my revenue 

is 

4 Mf father netted mi AotolictJp, {s^r,] Mr. Theobald fajra, ibt 
allufion is unfu^maUy /a Ovid. He i«.iotA%kfiiB. .Not <iiy die 
allufiom bfit tbe wjioie ig¥^ ^ taken from tiuian \ who appeaiv 
to have been one of bur roefs tivouriie authors, as may be col- 
leded from fever^I places of his works. It is from hit iifiwrp «t 
judicial Afit^9gy^ y/htrt Juiolicuj talks much, in the fame matiner; 
and 'tis only on this account that he is called tl^e fgn of Mercupy^ (ur 
theancientSy namely becaufe he was born under that planet. And 
as the in&nc v^ fuppoCed by the Aftrolc^ers to communicate of 
the nature of the itar which predominaud, fo Jutolicus vi'as a 
itief. • ■ 

5 apr re<oentu is the fiily ^heat.] Silfy is ufed by the writta di 
our auUior*ft time,^ for^iimpie, low, mean ; and in thU Che httAoar 

t («) /'•^/«?— Oxferd Edition— Vulg. p^i^'\ 



4^ 



The WiHTtH'i Taib. 

Is the filly cheat. G^Hows^ aed knock, are coo ponter- 
ful on the high*way ; beatii^ and faaHgii^ are c^rron 
to me : for the life to come, I deep out the thought 
of it. — A -prize ! a f>rizc! 

SCENE III, 

Enter Clown. 

Cfc. Let tnc fee,—— Every eleven weather tbds^ 
every tod yields pound and odd /hilling ; fifteen Ihin- 
drcd fhom, what Comes the w6ol too ? - 

jfut. If the fprindgc hold, the cock's mifht.^^\ 

Cb. I cannot do*t Wichotrt compters. Itt rtR^ftc, 
what am I to buy for our iheep^-fheariug feift; three 
pound of fugar, ftvc p6und of coframs, rioDH-**— i. 
what will this fifter of mine do with rice ? but my father 
hath made her miftfe&of the feaft, and (he hys if on. 
She hath made me four and twenty nof6>ga jrs for the 
Ihearers; three- man fong-men all, and very good 
dbes, but they are moft of them means and bafel ; bat 
onp Puritan among them, and he fihgs ^(kMi to horn- 
^' i muft have laffron to colour the warteri^^pies, 

^ iace dates none— ^that's outof rftynote: 

tltitmegs, ftven ; a race or two of ginger, buk tteit I 
may beg ; four pound of prunes, and as many raifins 
D* th* fun. . 

; jiuf. Oh, that ever I was born ! 

[GrobeUn^ cnihigftmd. 

Clo. Fth* liamc of nic ■ 

AMt. Oh, help me, help me: pluck butofftbeie 
tags,' and then death, death ^■' " " ■ 

of A^ fpeech coijfifts. I dbn*t s^^pitt to tfSaati mid KTgfi tklngs, 
,^ bridewell or the gallows ; I a)ii content with thi^'- bnniUe mi 
low way of life, as a fiiapper up of vnconjidird trifles. But the 
0;i|;^ri/ Editor, who, by his emeadations, feems tc^h^veftletlmd 
war againil all Shdkifpeai^ humour^ alters it to, thifiy theat. 

Clo. 




333 



334 ^' Winter/ Taik 

Ch,' A]ftck» poor icMfI> thou haft netd pf loorerag^ 
ID lay on ttiee, rather than have thefe off, 

jid. Oh, Sir, the loathfomnels of thciB c^ndsnxi 
more than the ftripes I have received, which are m^hty 
ones, and miUions. 

Clo. Aias, poor man ! a niillion of beating may 
come to a great matter. 

Aut. I am robb'd, Sir« and beaten ; my mony and 
apparel ta*en from me, and thefe deteftable things pa 
upon me. 

Ch. What, by a horfe-man, or a footman ? 

jbit. A footman, fweet Sir, a footnnaia. 

Go. Indeed, he (hould be a foot-man, by the gar- 
ments be hath left with thee i if this bti a bonfe-aiin'i 
coat, it hath feen very hot fevice. L^d me tby hwH 
I'll help thee. Come, lend me thy hand. 

jfut. Oh ! good Sir, tenderly, oh ! 

Clo. Alas, poor foul. 

Ait. O good Sir, foftly, good Sir : I fear, Sir, 07 
Ihoulder- blade is out. 

Clo. How now ? canft ftand } 1 

Aut. Softly, dear Sir; good Sir foftlyj youK 
done me a charitable office. 

Qo. Doft lack any mony i I have a little mofljl fof 
thee. 

j/ui. No, good fweet Sir j no, 1 bcfeech you, Sin 
I have a kinfman not pad three quarters of a mik 
hence, unto whom I was going, 1 fhall there 1»^ 
mony, or any thing I want : offer me no mony, 1 
pray you ; that kills my heart. - ^ 

Uo. What manner of fellow was he diat rol)ba 
you? 

Ail. « A fellow, Sir, that I have known »fp 
«* about * with trol-my-dames : I knew him once* 

6 'whhtfotmydames:'} Trou-madame, French. The gW»^^ 

" fcnrant 



4S 



Ti* WintbrV Taii. 335 

«^ (enrant of the prince ; I cannot cell» good Sir, for 

which of his virtues it was, but be was certainly 

whfppM out of the court 

GC^. ^^ His vices, you would lay ; there's no virtue 
^^ whipped out of the court ; they cherifh it to make 
** It ftay there, and yet it will no more but abide. 

Aut. Vices I would fay, Sir. I know this man well, 
** he hath been fince an ape-bearer, then a procefs- 
** lerver, a bailiff; then he compafi'd a ^ motion of 
*^ the prodigal fon, and married a tinker's wife within 
^< a mile where my land and living lies ; and, having 
*^ flown over many knaviih profelfions, he fettled 
*^ only in a rogue *," fome call him Autolicus. 

Ch. Out upon him^ prig! for my life, prig s «— 
he haunts wakes^ fairs, and bear-baitings. 

jfut. Very true. Sir; he, Sir, hei that's the rogue, 
chat put me into thb apparel. 

Ch. Not a more cowardly rogue in all Bohemia ; 
if you had but looked big, and fpit at him, heM have 
run* 

jfut. I muft confefi to you. Sir, I am no Bghter $ 
I am folfe of heart that way, and that he knew, I 
warrant him. 

Clo. How do you now ? 

-j^t. Sweet Sir, much better than I was; I can 
fiand, and walk ; I will even take my leave of you, 
^d pace ibfcly towards my kinfman's. 

Ch. Shall I bring thee oh thy way ? 

j4ui. Np, good-fac'd Sir ; no, fwcet Sir. 

Ch. Then, farewd, I muft go to buy fpices for our 
fheep- (hearing. \^Exii. 

jtut. Profper you, Iweet Sir ! Your purfe is not hot 
enough to purchafe your fpice. 1*11 be with you at 
your (heef)-lhearing too: if I make not this cheat 

7 motion of the frodigal fon^ u t, the Tuffti-Jht^v^ then called 
Motions. A term frequently occurring in our Author. 

bring 



33^ The WinterV Tali^ 

teing OK another, aod tbo fbnm» jpilU ' Bift iif i * ii( 
oe be uoroird, aod my name pw iin>«f))t book of 
virtue ! 

SONG. 

y^ on. jog OHj tbefoot'Pafb warf^ , 

Ana merrily bent theJUle- a. 
A merry heart goes all the day^ 

Tour fad tires in a mile-a. D^^ 

SCENE IV. 
yitf Pro^ of a Shepherd' i Cotte, 

Enter Florizel and Perditt. 

jRfe. 'T^HBSE your timifaa! weeds to each part of 

X you 
Do give a life : no ftiephcrdefi, bat Bora 
Peerifig in Af^^s front. This your flieef^^fliearing 
Is as a meeting of the petty gods. 
And you the Queen on*t. 

Per. Sir, my gracioas lord, ^ .. ^ • - 

To chide at your extrcams it not becomes me ! ". - 
Oh pardon, that I name them : your high (elf, '^ 
The gracious mark o'th* land, you have obfcui^ ^ 
With a fwain^s wearing ; and me, poor lowfy ittaid;'^ 
Moft goddefs-lxke pranked up. But that our feafb ^^ 
In every mefs have folly, and the feeders '^^ 

Digeft it widi a cuftom, I Ihould btafh "' * ^ 

To fee you fo attired; •fworn, I think^ ^ ^„. . , .., 

8 Jtt meh9 tmnll^J, -mtd m^^tami put into the h»k if <flrtmg ff^ 
Be^nggipfies, in the time of oar aQthor, wtre io gangs ainftSA-; 
nuiies, t£it had femecbing of tbe ihcw of an incorponted Bafff . 
Fiom this noble fockt/ mt wiftcs he maj be tUKUJSV^ does 
not fo and fo. "^^ - ^ 

7o^w mffiif a glafi.} u §. one would think flM ia fMri 
on this habit of a ihepheid, yon had fwenn cb pat aie Mt 



The Winter/ Tale. 337 

To ihcw fnyfrlf a glafs. 

Fi^. I blels the time^ 
When my good fa?con made her flight a-crofs 
Thy father's ground. 

Per. Now Jove afFord you caufc ! 
To me the difference forges dread, your greatnefil 
Hath not been us'd to fear ; even now I tremble 
To dxnk, your father, by fome accident. 
Should pais this way, as you did : oh, the fates! 
How would he look, to fee his work, fb noble, 
Viklly bound up f what would he &y ! or how 
Should I in thefe my borrowed flaunts behold 
The ftemneis of his prefence ! 

Fb. Apprehend 
Nothing but jollity : the Gods themfel ves. 
Humbling their deities to love, have taken 
The ihapes of beafts Upon them. Jupiter 
Became a bull, and bellow'd ; the green Neptum 
A ram, and bleated ; and the fire-robM God, 
Golden yfpotto^ a poor humble fwain. 
As I ieem now. Their transformations 
Were never for a piece of beauty rarer. 
Nor in a way fo chafte : lince my defires 
Run not l^efbre mine honour, nor my lufts ^ 
Bom hotter than my faith« 

Per. Oj but, dear Sir, 
Your rdblution cannot hold, when *tis 
^Pppoa'd^ as it muft be, by th' power o' th' King. 

co uu te na ncei for in this, as iti a glafs, you Ihew me how much be- 
ham-jmiMSywk muft defcend before yoo can get upon a leird with 
• tte. Tiie foBtimenc is £ac» and c^preflci all the delicaqr* as well 
as hamUe modefty of the chara&er. But the Oxfird Editor alters 
it to, 

■ ■ ■ /w^sr, / think f 
To /hew myjeif m glafs. 
What 1m means I doD*t know. Bat P/riilri* was BOt fo mnch gli^eo 
ao/awiiy» aaa^jMart hy her htthaviour at the King's threats, wl^ 
th» iacrigw was difooveicd* 

Vol- IIL Z One 



n 



338 The Winter^ Tale* 

One of thefe two mud be necefljties^ 

Which {ben will fpeak> ihat you mud change cfaift 

purpofe. 
Or I my hfe. 

Flo. Thou dcareft Perdita^ 
With thefe forcM thoughts^ 1 pr'ythce, darken noc 
The mirch o'th' feaft ^ or Til be thioe, my fair^ 
Or noc my father's, . For I cannot be 
Mine qwn, npr any thjog to any, if 
I bejppc tbine* To this I am mod conftant^ 
ThV d^iny lay no. Be mcrry^ (GciHlc^) .^ 
Strangle fuch thoughts ^{^. thefe» with aoyjiuog 
That yog behoiel th^.while* Your gpefts arecoming: 
Lift up your countenejpicCf lis 'cwepe the day * 

Of celebration of that nuptial, which , - 
We two h^ve fworn (hall c^me. A) 

Per. O lady fortune, • nV/ 

Stand you aufpaciousj i - ."1 



,11 1.1. .« 



■ -y - S -C E N E Vv 

Enier Shepherd ^ Climn^ Mopfa, Dotc&^'Slei^^^n&x 
wilh^ Volixcnes and C^rni\l<y'J^^ -'^ ** 

Flo. See, your gucfts approach r . >// .^ 
Addrefs yourfclf to entertain them fprlgjbtlyt . ^q 
And let's be red with .mirth. . ,:j"' 

SJ:>e^ *' Fice daughter i when my old wifelivM^ upon 
*''T*hts clay fhe was both panckr, butloy cooW 
*' Both dame and lervant \ welcom'd al|^. ^enr'd^all ; 

Would ling her fong, and dance her turn ; now 

At upper end o*th' table, now Tth'niiddle: 
*> ^n Ill's (houlder, and his ; her face.o* ^. . 
** ,With labour ; and the thing Oie topkto qUQO^ k 
•^ Stic would to e<ich one fip," You are retired^ 
As if you were a feafted one, and not 
The hoftcfs of the meeting: pray you, bid , ., 






J • •> 



7he Winter*/ Tale. 339 

Thcfe unknown friends to*s welcome, for it is 
-A wny'to make us betcer friends, more known. 
Come, quench your bluihes, and prefent yourfclf 
That which you are, miftreis o*th' fcaft. Come on. 
And bid us welcome to your iheep^fhearing, 
As your good flock fhall profper. 

Psr- Sirs?, welcome. [Xo Pol. and Cam; 

It is my father*s will, I fhould take on me 
The hoftefsfhip oWday ; you're welcome. Sirs. 

Give me ttiofe flowers there, Dorcas — Reverend Sirs^ 

** For you there's rofcmary and rue, thefc keep 

** Seeming and favour all the winter long t - 

^ Grace and remembrance be unto you bbth,^ 

** And wekofne to our fhearbg ! '' 

Pol. Shepherdefs, 

(A fair one arc you,) wcB you fit our ages ' 

With flowers ot winter. 
Per. "Sir, the year growing ancient, 

•* Not yet on fummer's death, nor on the birth 

^* Of trembling wither, the £iireft flowers o'th' fcafooi 

** Are our carnations, and ftreak'd giIIy*flowers, 
. ff., eMUiich fome call nature's haftards : of that kind 

^ Our mj^k garden's barren, and I care not 

•• To get flips of them. 

Pol. Wherefore, gentle nuiden. 

Do yolf heglea them ? 

P^. ** For I have heard it (aid, 
"^/TKeri is an art, which in their piedenefi fluurcs 

*« WVii great creating nature. 

* • :\A7. Say, there be ; 

Yci nature is made better by no mean, 

** But nature makes that mean ; fo over that ar^ 

** Whicfi, you fay, adds to nature, is an art 

^^' That nature makes -, ypu fee, fwcet auid, we marry 

•* A gentle fey on to the wildeft ftock ; 

^^ And make conceive a bark of bafer kind 

** By bad 'of nobler race. This is an art, 

Z 2 •* Which 






cc 
cc 
cc 
cc 



340 !7l^ Winter'j Talb. 

*< Which does mend naturCi changjc it rather ; but 

*' The art icfclf is nature. 
Per. So it is. 
ToL Then make your garden rich in gilly-flowersi 

And do not call them bafUrds. 
Per. " rU not put 

The dibble in earth, to let one flip of them : 
No more than, were I painted, I would wifli 
This youth ihould iay, 'twere well \ and only there<» 
" fore 

^ Defire to breed by me. — Here's flowers for you \ 
Hot lavender, mints, lavoury, marjoram. 
The mary-gold, that goes to bed with th' fun. 
And with him rifes, weeping: thefeare flowers , 
Of middle fummer, and I think, they are given 

•* To meniof middle age." Y'are very welcome 
Cam. I ihould leave grjizing,^ were I of your flock. 

And only live by gazing. 
Per. '• Qur, ai^s I 

«< You'd be fo lean, that blafts of January 

" Would blow you through and through, Now^my 
faireft friend, 

^* 1 would^ I bad fome flowers o'th' fpring^ that might 
Become your time of day ^ and yours, and yours,. 
That wear upon your virgin- branches yet 

" Yot)r maiden-heads growing: C) Pn^ferfina^ 
For the flowers now* that, frighted^ thou let'd iail 

*' From Dis^s waggon ! da^adtls, 

^' That come befol-e the iw^Ibw dares, an() take 

^* The winds of March with beauty ; violets dim. 
But fweetcr than the lids of Jund^i eyes. 
Or Cjtherea^s breath ; pale primrofes, 
That die unmarried, ere they can behold 

V Bright Pbeshus in his ftrength ; (a malady 

*^ Mod incident to maids i) {a) gold oxHps, and 

[ [a] gold, Oxford Editor— —.^a^. beU'^ 



CC 

cc 
cc 
cc 



cc 
cc 
cc 



Tht Winter/ Tale. 341 

«• The crown-imperial ; lillics of all kinds, 
•* The flowcr-de-lis being one. O thcfe^.I lack 
^* To make you garlands of, and, my fweet friend, 
** To jftrQw him p*er and o'er. 

Flo. What ? like a coarfe ? 

Per. No, like a bank, for love to lie and play on; 
Not like a coarfe j or if,— - not to be bUricd 
But quick, and in mine arms. Come, take your flowers; 
Methinks, I play as I have feen them do 
In whitfon paftorals: fure, this robe of mine - - 
Does change my difpolition. 

Flo. What you do. 
Still betters what is done. When you fpeak, (fwcet) 
I*d have you do it ever ; when you fing, ^ 

rd have you buy and fell fb ; lb, give alms ; 
Pray, fo •, and for the ordering your affairs. 
To fing them too. When you do dance; I wi(h you 
A wave o'th' fea, that you mi^t ever do 
Nothing but that ; move ftill, ftiil fo. 
And own no other fundion*. Each your doings 
So Angular in each particular. 
Crowns what you're doing in the prefcnt deeds. 
That all your a<fls arc Queens. 

Per. O DoricleSj 
Your praifes are too large ; but that your youth. 
And the true blood, which peeps forth fairly throi^ ify 
Do plainly give you out an unftain'd (faephefd ; ' 
With wifdom I might fear, my Doricles^ 
You woo'd me the falfe way. 

Flo. • I think, you liave 
As little skill to fear^ as I have purpofe 

• 

I — / fhinif you have 

Jj liitie skiH tB/sar'"-^^'] T9 Ufft sMUh d§ m Mag^B/^u 
phrafe then in life equivaleai co our t0 havi rutfia tfi 4o a t^iwg* 
The Qj^rdidMf^ IgfioraQt. of this* alters it to; 

As little skill inftar\ — * 
which has no Idnd of fenfe in this place. 

Z% To 






7i« Wi N T I iCs T A Lis: 

To put ypu to*t. But, come j our dance^ I pray % 
Your hand, my Perdita ; fo turtles pair,. 
That never mean to part. 

Per. ril 1 wear for *cm. 

Pol. *' This is the prctticft low-born la(s, that ever 
^^ Ran on the green-ford ; nothing fhe does, or (eems. 
Bat imacks of iomeihing greater than her felf^ 
Tba noble for this place. 
: : Cam, He tells her ibmething, 
That aaakes her blood look {a) out : good footh| 

liieia 
The Queen of curds and cream: 

C/<7.*i^me on, ftrike up. 

Dor^ A&pfa muft be your mi(lreis ; marry^ garlick 
:to tncni hct kifBng with^"' ■■* 

Mop. Now, in good time! 

Xit^ki.Neta.word, a word ; wc lUnd upon our man- 
tiers ; come, firike up. 

Here a dance of Shepherds and ShepberdeJ/es. 

Pol Pray, good fhepherd, what fair Twain is tlw 
.Who danws wiih your daughter ? ^ 

: Shep^ They call him Doricks^ and heboafts himMf 
To iave * a worthy breeding ; but 4 have it 
/Upon bis oytn report, and I believe it 4 • ^ . '• • - *" 
He looks like footh } he iayis^ he loves nry dau^tt)^ 
* I think fo too ; for hevec giz'd themickm ^- . "^ 
Upoa tbewacer, as heUl ftand/andYcad'^-^f^^ 
As 'twere ipy daugjhttnts eyfs ; aAd, oo be|{la«n, 
I. tbJnk« there is notiialf a!kii(s to ckufit'i sH - 
"Who loya»i>«jM)ther bcfty •► .. . ... a ^e,.. \.-^ 

^«/..5rji? dances fcatlyVj x- ^'^ *^ ' ' ' - 

SBep. She doesanjr thing, tho' I t^pM^w 



Da tight upon her^ (be ihall bring him That 
Which he noCdmms of. . • i. * 

f • »- - 

S C E N E VI. 

Enter a Servant. 

Ser. Q. mafter^ if you did but hear thepedlcrift 
the door, you would never daiice again afer a labor 
and pipe : no, the b2(g*pipe could aot moire yoaV he 
fings feveral tunes, fader than youHl ' tdbimony ^ .lie 
utters them as he had eaten ballads, and ail mens' ears 
grew to his tunes. i^ . . .. ■ 'V • 

Clo. He could never cQme.better v he cfbaU come 
in i I love a ballad but even too well, rf^^t be6ole- 
ful matter merrily fet down ; or a very. ^>lear2i»t thing 
indeed, and fung lamentably. . , ' /' 

Ser* He hach fongs for nian, or womaD^'^oPall fiaes ; 
no milliner can fo fit his cuftqmerc with^glovesf : he 
has the prettied love-fongs for maids, lo without - 
bawdry, "(which is ftrange) with fuch delicate burthens 
of dil-{io's and fa*ding*s: jonnp her and th^mp'her: 
and where fbme dretch-moqth'd rafcal would, af it 
iviere, miean mifchief, and break a foul gap into the 
matter, he makes the maid to anfwer, Whoopj do me 
no barm^ good man ; puts him oflf, (lights him^ widi 
ff^koopj 4offe no barmy good man. 
' Pol. This is a txnve fellow. 

Qo. Believe me; thoo talkeft of an admirable-con- 
freited iettow % has he any tinbraided wares ? 

Ser. He hath ribbons of all the colours i*ch' rainbow \ 
points, more than all the lawyers m JB^^wiitf can learn- 
edly handle, though they conic to him by the grols } 
inkles, cacMifies, cambricks, ^wns ; why, he fings 
them over, ^ they^ were Gods and Qoddeffts j you 
would think a fmock were a flie-angel, he fo chants tq 
l^e {a) fleeve-band and the work ateut the (quare on^t. 

r (a) JUtoilmL Oxte4.Bd!tor-«Viilg. i«-£0i»/] 

24 Ch. 



'. Ci^ rJfy^jihecy hriog.fatmtn ; and Ir biin tpproacht 

F.^r. Forewarn hioi$<hat be ufe lut fcorr ilous words 

Qo. You have of thefe pedlers that have more in 
*fiKQ than you'd chinkt lifter. 
Per. Ay, good brother, or go about to thinks 

Enter Autdicus ftngit^. 

Lawn as wlnte as drvoenfnjm 
' - Cyp^^s black as e^er was cro^ j 
Glcrves as fweet as damask rofes^ 
^ . Masks for fac^s andfor-nofes ; 
'Bugh braceletSy neck-lace amber^ 

Perfume for a ladfs cbamlfer: 
J Gol(ien quoifsj and ftomacberjy 
.. *? , For my lads to give their dears .• . ^ 

y ^ Pins^ and poaitng-Jlicks of ^fieel^ 

JVbat maids lack from head to heel : v 

^^793^ buy of me^ come : come huy^ comi bux% 
Buy^ ladsy or elfe your lajfes c^ry. .^£gJ 

Come buy^ &c. 

Clo, If I were not in ]ove with M^fa^ thou fhoutd'ft 
tul^i; no mony of me ; but being enthrg'll'd ts I ^tm, 
k wi^.i^fi) be the borage of certain ^ ribbooa nsA 
gloves. ' . 

Mop. I was promised them againft ihe feaft, .but 
they coqie' not too late ^now« , . ^ ^ 

Dor. He hath promised you more than that, <tf 
fherc be^ liars. ♦ V^ 

iVi^ip. He hath pai.d you all he promls'd you : 'niay 
be, he has paid you more i which will fhame you to 
giye him again. 

' Cto. Is there no manners left among maids? will 
they wckr their placket^,^wbcre they flioulctwcar dwrir 

faces ? 



faces ? 19 there not inHking^tim^, whert ycm are go7ng 
to bed, or kill-hole, to whiftle of thefe fecrets, but yoa 
muft be detle-tattling before all our guefti f *tis well, 
they are whifpring : [ clamour your tongues, and not 
at word more. 

Mop. 1 have done : come, you promised me a taw- 
dry lace, and a pair of fweec gloves. 

Clo. Have I not told thee how I was cozened by the 
way, and loft all my mony ? 

jfut. And, indeed. Sir, there are cozeners abroad* 
therefore it bthoves men to be wary. 

Qo. Fear not thou, man, thou (halt lofe nothing 
here, 

jfut. I hope To, Sir, for I have about me many 
parcels of charge. ^ * 

do. What haft here ? ballads f 1 

Mop. Pray now, buy fome ; T love a ballad in 
print, or a life ; for then we are fure they are true. 

jfut. Here's one to a very doleful tune, hpw a ufurer*s 
wife was brought to bed with twenty mony bags at a 
buitbeb ; and how fhe long'd to eat adders* heads, and 
toads carbonadoM. 

Mop. Is it true, think you ? 

Aif. Very true, and but a month old. 

X)^* Blefi me from marrying a ufurcrf 

jiui. Kerens the widwifc*s name to't, dne thiftitfi 
Tale^pornfj and five or fix honeft wives that weite 
prefent. Why fhould I carry lies abroad ? ^ 
^ Mop. Plray you now, buy it. 

Clo. Come on, lay it by ; and let^s firft fee morft 
baHads;' we'll buy the other things anon. 

jfta. Here's another ballad, of a fi(h that appeared 
upon die coaft, on fTednejSay the fooricore of utpril^ 

3 Clamoar yeur tongues,'] The phrafe is taken fiom liaginf» 
When belis are at the height, ia order to ceafe them, the lepeti* 
tlon of the firokes becomes much quicker .chan before 5 this is 
aUed etamouring them. The alhi£on is hnmoorooSi 

forty 



346 Tie WiNTBU'j Tali. 

forty thoiifand fadom -above water, and fung this bal- 
hd againft the hard hearts of maids ; it was thought, 
ihe was a woman, and was turn'd into a cold iifh, for 
(be would hot exchange flefli with one that lov'd her; 
the ballad is very pitiful, and as true. 

Dor^ Is it true too, think you? 

yfuf. Five juftices hands at it \ and witnefles more 
than my pack will hold. 

Clo. L^y it by too: another.—— 

jItiL This is a merry ballad, but a very pretty one. 

Mop. Let's have fome merry ones. 

jitit. ^hy, this is a paffing merry one, and goes to 
the tune of Two maids wmng a man \ there's fcarce a 
maid weftward, but (he fings it ; 'tis in rd^ueft,. I can 
tell ytni. 

Mop. Wc can both fing it ; if tbou'lt bear a p^r, 
thou (halt hear, 'tis in three parts. 

Dor. We had the tune on't ^ month ago. 
' jIuI. I can bear' my parti you muft know^ •tis my 
pcfupation : have at it with you, 

Aut. Get you bence^ for I mufi go^ " " 

Where it fits not you to knctv. 

Dor.* Whither? '" ^ ' 

Mop: O tvbither ? 

Dor. Whither? 

Mop. // becomes thy oath full well^ 
Thou to me thy fecrcfs tflh 

Dor. Me tooy let me go thither: 

'Mop. Or thou goejl to the grange^ of mill^ 

Dor. Jf to either thou doft ill : 

Aut Neither. 

Dor. What neither? 
* Aut. Neither. - " 

Dor. Tbon baft /worn my love tohex 

Mop. Thou baftfijoom it more to me: 

7ben whitber goeft ? fay^ nvbitberf . 



Thdi WiNTEK/ Talb. 347 

. CU. We'll have thifl fong out anon by ourielves : 
my father, and the gentleipeo are in fad talk^ and 
we'll not trouble them : come, bring away thy pack 
after me. Wenches, Til buy for you both : f (xller, 
let's have the firft choice : follow roe, girls, 
jtut. And you (hall pay well for 'em. 

SONG. 

JFill you buy any tape^ mr lace for your cape^ 

Mf dainty £uk^ my dear^ ? 
Andfilk^ and thready any toys fcryour bead 

Of the nevfji^ andfm% Jin' ft wcar-A ? 
Come tojbe Pedler ; mo^^s a medler^ 

Tb^ dotb utter all mem xvare-a* 

[Exe. Qown, Autolicus, Dorcas, and MopCu 

S C E N' E VII. 

Enteir a Servant. 

. Ser. Matter, there are three carters, three Ihep- 
herds, three neat-h?rds, and three fwine-herds, that 
have made themfelves ^ all men of hair, they call them- 
fel ves Saltiers : and they have a dance, which the wenches 
fay is a ^allymaufry of gambols, becaufe they are not 
in't: but they themfelves areo*th' mind, (if it be not 
top rough for fome, that know little but bowling,) it 
il^ill pleafe plentifully. 

Sbep. Away ! we'll none on't ; here has been too much 
hom^jy foolery already. I know. Sir, we weary you.- 

Pol. You weary thofe, that refrefh us : *pray i let's 
fee thefc four-threes of herdfmen. 

Ser. One three of them, by their own report. Sir, 
hath danc*d before the King *, and not the worftof the 
three but jumps twelve foot and a half by th^fqvare* 

4 a/I men of hair,'} /. r. nimble, that leap at tf they itboonded: 
The phrafe is taken from Unms-balls^ which were finflU with hair. 
So in Henn V. it is faid of a courfer. 

He pounds as if his tntraits ^wen iairs% 

Sbepi 



3+8 ' the V/inTEK's Tali. 

Sbep. Leave your prating^ fincc thefe good men are 
pleas'd, let them come in j but quickly now. 

Here a Dance of twelve Satyrs* 

' Pol. O, father, you'll know more of that hereafter 
Is it not too far gone ? 'tis time to part them ; 
He's fimple, and tells mpch. ■ How now, feir 

ihepherd ? 
Your heart i$ full of fomething, that doth take 
Your mind from feafting. Sooth, when I was young. 
And banded love, as you do, I was wont 
To load my (he with knacks : I would have ranfack'd 
The pedler's filken treafury, and have pour*d ic 
To her acceptance % you have let him go. 
And nothing marted with him. If your lafs 
Interpretation fhould abufe, and call this 
Your lack of love or bounty ; you were ftraited 
For a reply, at leaft* if you njake care 
Of happy holding her. 

Flo. Old Sir, I know, ^ ' 

She prizes not fuch trilles as thefe are ; 
The gift$> ihe looks from me, are packt and lockt. 
Up in my hearty which I have given already, '^ 

But not dcliver'd. O, hear me breathe my love 
Before this ancient Sir, who, it fhould feem. 
Hath fometime lov'd. I take thy hand, this haf)d^ 
As foft as dove's down, and as white as it. 
Or Etbiopiun^^ too(h, " or the fann'd fnow 
*• That's bolted by the northern blaft twice 6*er. 

PoL What follows this ? 
How prettily the young fwain ieems to wa/h 
The hand, was fair bp/ore ! I've put you out j 
But, to yoiir proteAation : let me hear 

5 Pol. 0,fiuberypu*U kmo m^re »/ th^t hrutftir."^ This is 
replied by the King in aofwer to the fh;pherd*s hyvn^Jimte ihtft 
good men art pUafed, Yet the Qjr/ffry Editor, I can't tell Why, gives 
thit line to Fkrixil^ fincc FlonTnl and (he old man woce not in 
CO#Mer(ation. 

What 



Tt)e Winter'^ Tah. 34^ 

"What you profefi. 

Flo. Do, and be witnefs to't. 
Pel. And this my neighbour too ? 
Flo. And he, and more 
7han he, and men -, the earth, and heavens, an^ all ; 
That were 1 crown'd the mod imperial monarch 
Thereof moft worthy, were I the faireft youth 
That ever made eye fwerve, had force and knowledge 
More than was ever man's, I would not prize them 
Without her love j for her imploy them all ; 
Commend them, and condemn them, to her fervice^ 
Or to their own perdition. 

Pol. Fairly offer'd. 

Cam. This (hews a found afieftion« 

Sbep. But, my daughter. 
Say you the like to him ? 

Per. I cannot (peak 
So well, nothing fo well, no, nor mean better. 
By th* pattern of mine own thoughts I cut out 
The purity of his. 

.Sbep. Take hands, a bargain ; 
And, friends unknown, you ihall bear witnefs to't: 
I give my daughter to him, and will make 
Her portion equal his. 

Flo. O, that muft be 
I'th* virtue of your daughter ; one being dead, 
I (hall have more than you can dream of yet, 
Enough then for your wonder : but come on, 
Cbntrad: us Tore thefc witnefles. 

Sbep. Come, your hand. 
And, daughter, yours. 

Pol. Soft, fwain, a- while j 'bcfeech you. 
Have you a father ? 

Flo. I have ; but what of htm ? 

Pol. Knows he of this ? 

Flo. He neither does, nor ihail. 

Pol. Me thinks a father 

Is, 



350 "Jiht WiNTER'i Tale, 

Is, at t^ nuptial of his fbn» a gueft 

That beft becomes the table ; *|>ray you once fnorcy 

Is not your father grown incapable 

Of reafonabie affairs ? is he not ftupid 

With age, and' altering rheunis? can he fpeak? hear? 

Know man from man ? difpute his own eftate ? 

Lies he not bed-rid ? and, again, does nothings 

But what he did being chUdUh ? 

FIq. No, good Sir > 
He has his health, and ampler ftrength, indeed^ 
Than mod have of his age, 

TcL By my white beard. 
You ojffer him, if this be fo, a. wrong 
Something unfi] ml: Reafon, myfim - 
Should chufe himfelf a wife; but as good realoD) 
The father (all whofc joy is nothing elfe 
But fair pofterity) fhould hold fomc counfcl 
In fuch a bufinefs. 

Flo. I yield all this ; 
But for fome other reafons, my grave Sir, 
Which 'tis not fit you know, I not acquaint 
My father of this bufinefs. 

Pol. Let him know't. 

Flo. He fhall not. 

Pol. Pry'thee, let him. 

Flo. 'No ; he muft not. 

Sbep. Let him, my fon, he fhall not need co gricva 
At knowing of thy choice, 

Flo. Come, come, he muft not : 
Mark our contradt. 

Pol. Mark your divorce, young Sir, 

Xpifco%ering bimf(l[. 
Whom fbn I dare not call : thou art too bafc 
To be acknowledged. Thou a fcepter't hcir> 
That thus afFecfft a iheep-hook ! Thou old craytor, 
Pm forry, that, by hanging thee, I can but 
Shorten thy life one week And thou frelh piece 

Of 



Thi VXTiNrER*/ Tale. 351 

of excellent witchcraft, who of force itiuft know 
The royat fool thou coap^ft with 

Sbep. O my heart ! 

Pol. rU have chy beauty fcratchM with briars, and 
made 
More hoinely than thy ftate. For thee, fond boy. 
If I may ever know thou doft but figh 
That thou no niore (halt lee this knack, as never 
I mean thou Ihak, we*ll bar thee from fucceflSon i 
Not hokl thee of our blood, no, not our kin. 
Far* than Deucalion off : mark thou my words ; 
Follow us to the court. Thou churl, for this time, , 
Tho' full of our difplcafure, yet we free thee 
From the dead blow of it : and you, enchantment, ^ 
Worthy enough a herdfman ; yea him too. 
That makes bimieir, but for our honour therein. 
Unworthy thee *, if ever, henceforth, thou 
Thefe rural latches to his entrance open. 
Or hoope his body more with thy embraces, 
I will devife a death as cruel for thee. 
As thou art^iender to it* [Exits 

t • 

SCENE VIII. 

Per. Even here undone : 
«• * I was not much afraid ; for once or twice 
/*u I-Was about to fpeak, and tell him plainly, 
*'^ The felf-fame fun, that fhincs upon his court, 
** Hides not his vifage from our cottage, but 
** Looks on alike. — Wilt picafe you. Sir, be gone? 

[To Florizd. 
J told you, what would come of this. *Befcech you. 
Of your own date take care : this dream of mine, 

6 1 was mt mmcb tfraUi ^c] The Chara^let* is here fi|iely Tuf^ 
taincd. . To have made her quue ailonilhed en the king** diico- 
vefy of huxirelf, had not become her bixih; and to have giveo hier 
pre&nce of irxnJ to have made this reply to the King, had not 
becoA^-^lKr cdacaciod. 

" Being 



352 ^ WinterV Tale. 

** Bcmg now awake. Til queen it no inch farther^ 

*• But milk my ewes, and weep.** 
Cam. Why, how now, father? 

Speak, ere thou dieft. 

Sb^. I cannot fpeak, nor think. 

Nor dare to know That which I know. O Sir, 

[To FlorizcL 
7 You have undone a man of fourfcore three. 
That thought to fill hi$ grave in quiet; yea. 
To die upon the* bed rny father dy'd. 
To lye clofe by his honefl: bones i but now 
Some hangman muH: put on my fhrowd, and lay me 
Where no pried (hovels in duft. O curled wretch ! 

ITo Perdita. 

That knew*ft, This was the Prince ; and would'ft ad- 
venture 

To mingle faith with him. Undone, undone? 

If I might die within this hour, I have liv'd 

To die when I dcfire. [^Exil. 

SCENE IX. 

^ . . • ■ 

Flo. Why look you {o upon me? 
I am but forry, not afraid ^ d^lay'd. 
But nothing alter'd : what I waSt I ?^^ ; 
More (Iraining.on, for^hjckiqg back a ttot following 
My lealh. uawillingly. 

Cam. Gracious my Lpprd, 
You know ^our father's tenjper : at this taint 
He will allow no fpeech, (which I do gucfs, 
Tou do not purpofe to him i) and as hdUdly 
Will he endure your fight, a$ yet IJcar; 

7 Tht iavg tmdowi n man offigrfc^i ihrii^ &c.] Tlwefe fiatf* 
mencsy which the Poet has licighcen*d by a ftrain of ridicuk Uat 
runs thro' them, adminbty charaAerize the fpeaker ; winle fel- 
fifhnefs is feen in concealing the adirenture of FerdiUti aad hat 
fupf»rted, by ihewing no regard for his foD or her, bat bang odeca 
up entirely with himielf, iiiiQ/ag\ifiMrfi0r$ iknt. 

' Then, 



Thf WiNTBRx Tali* j^ 

Then, 'till the fury of his Highnefs fettk, m : 
Come not before hitn. 

Fh. I not purpofe it. 
I think, Camillo^^—^ 

Cam. Even he, my Lord. 

Per. How often have I told you, 'twould be thus? 
How often faid, my dignity would laft 
But 'till ^twere known i 

Flo. It cannot fail, but by 
The violation of my faith, and then 
Let nature crufh the fides o'th* earth tc^ether^ 
And mar the fccda within !-— rLift up thy looks!— • 

>From my fucceflion wipe me, father, I 
Am heir to my affedtioa. 
Cam. Be advis'd. 

Flo. I am i and by my fancy ; if my reaiba 
I Will thereto be obedient, I have realbn 5 . '^ 

' If not, my fenfes, better pleased with madnefs^ 
Do bkl it welcome. ^ 

Cam. This is defperate. Sir. 

Flo. So call it ; but k does fulfil my vow % 
I needs muft think k honefty. CamiUo^ 
Not for Bohemia J nor the pomp that may 
Be thereat glean'd ; for all the fun fees, or 
The clofe earth wombs, or the profound feas hide ^ 
InlUnknown (adorns, will I break mj oath 
To this my fair belovM : therefore, I pray you. 
As you have ever been my father's friend, 
When he fliall nufs me, (as, in faith, I mean not 
To lee him any- more) call your good counlels * ^ ' 
Upon his paflion ; let myfeif and fortune 
Tug foi- the time to come. This you ttiiy know^ 

''d {o deliver, I am put to fea 

ith her, whom here I cannot hold on (hore 1 
And, moft opportune to our need, I have 
A vcfTel rides fall by, but not preparM •. 

For this defign. What courle I mean to hold 

yofc III. A a Shall 



t^i 



354 ^ WinterV TAtB. 

Shall nothing benefit your knowledge, Aor 
Concern me the repcM-ting^ 

Cam. O my lord, 
I would your fpirit were eafier for advice. 
Or ftrongsr for your need. 

Fh. Hark, Perdiia 
ril hear you by and by. [To Caoi. 

Cam. He's irremoveable, 
RefolvM for flight : now were I happy, if 
His going I could frame to ferve my cum ; 
Save him from danger, do him love and honour ; 
Purchafe the fight again of dear SidUa^ \ 
And that unhappy king, my mafter, whoin 
I fo much thirfi: co fee. [4fiJe. 

Flo. Now, good Camiilo \ 
I am fo fraught with curious bufincfi, that 
I leave out ceremony. 

Cam: Sir, I think, 
You have heard of my. poor fervicQB, i*th' lave 
That I have borne your faditr? 

Fh. Very nobly 
Have you deferv*d : it Is my father's mufick 
To fpeak your deeds, nor little of bis care 
To, have them recompensed, as thought on. 

Cam Well, my lord, ' * 

If you n>ay pleaie to think I lovethc King, ^ T 
And through him, what's neareft to. him« wliicfaris 
Yoi^r gracious felf, embrace but my dinsftion 4 
(If your more ponderous and (ettl^ projeft: 
May fufFer alteration,) .on mine honpdr, 
rU^point you where you (hall have fuch receiving' 
A^ ihall become your hjghnefs, wheije you Oiay 
Enjoy your miftrefs j from the whom, I ft^ 
There's no disjundlion to be niade, but by » 
(As, hcav'ns forefend !) your ruin. Marry hei^ 
And with my bed endeavours, in your abfence, 
Your difcontented father I'll firivc co qualifie. 

And 



The WiM'THR^j'TAtti 355 

And btfk)gl|iin up » liking. 

FJo. jiaw, Camilkj 
May this, almoft a miraclie, be done f 
That I may call thee fooMdiing mone dum mao^ 
And after That truft to thee? 

Cam. Have you thought OQ 
A place whereto joi^Il go i 

Fk. Not any yet : 
But as th*UBthou^*on accident b goilqr 
Of ^hat we wildly do, fo we profefi 
Ourlelves to be the flavca of chance, and flics 
Of ever^ wind that blows. 

Cam. Then lifttoinei 
This follows, if you will not change your purpofe^ 
But undergt^ this flight, make for Sitilia > 
And there prefent yourfelf, and your fair Princels 
(For ib, I ice, flie muft: be) 'fore JJontes ; 
She ihall be habittd, gff jt bocqaies 
The partner of your bed. h^JMethinks, I iiee 
Leontes opening his free 4fiik>a^ iM^d weqpbg 
His welcoiBes forth ; i^s thee, the ion, lorgivoiefiy 
As 'twere i'th* Other's perlbn ; kifiTes the hfnds 
Of your frelh Prinoefs ; o'er and o'er divides hinrn 
'Twixt his unkindnefs, and his Jkiodoefs : ch' one 
He chides to hell, and bids the other g^ow 
Fafter than thought or time. 

Fh. Worthv CamUlo^ 
What coiour for my vification (hall I 
Hokl up before him ? 

Cam. Sent by the King your father 
To greet him, and to give him comforts. Sir* 
The ntanner of your Bearing towards him, with 
"What you, as fitom your £ither, (hall deliver, 
'^Hiingsiknown betwixt us three, FU wrke you down i 
* The which /hall point you forth at every Qcting, 
^ What 

8 7bi 'which fiall fdnt J9U firth mf every fitting,] Enfery fittings 
fa/6 Mr« JbiebeUd, methMiy gi*ves us hui m 'very fo$r idem, fiac a poor 

Aa 2 idea 



35^ ^* Winter** TalU. 

What you muft lay ; that he (hall not peroeive^ 
But that you have your &thet^s bofom there^ . 
And fpeak his very heart. 

Flo. I am bound to you: 
There is fome lap in this. 

Cam. A courie more promifing 
Than a wild dedication of your felves 
To unpath*d waters, undreamed (horcs ; moft certaio, 
To miieries enough : no hope to help you. 
But as you (hake off one^ to take another : 
Nothing fo certain as your anchors, who 
Do their beft office, if they can but (by you 
Where you*il be loch to be : befides, you know» 
Profperity*s the very; bond of love, 
Whofe tre(h complexion and whofe heart together 
Afflidlion alters. 

Per. One of thefe is true: 
I think, affliAion may fUbdue 'the cheeky 
But not take in the mind. 

Cam. Yea, fay you ib? 
There (hall not at your £idicr*$ houTe,^ thefe ievcD 

ycan,- 
Be born another fuch. 

Bo. My good Camilh^ 
She is as forward of her 'Breeding, at 
She is i'th* rear o* our birth. 

Cam. I cannot fay, 'tis Pity > * 

She lacks inftruftions, forihe feemsa miftrrfi 
To moft that teach. 

Per. Your pardon, Sir, (or this : • . 
ril blu(h you thanks* - - 

idea is better than none ; which it eomes ttv whtn he hat aberM k 
tai^try fitting. The truth it. the common reading it verr ex* 
preiilve ; and means, at every audience yoo (hall have of theuf 
and Council. The Council-dayi beingt in our author^t time, cal« 
led, in common fpeech, th$ Sittingt. 



The WinterV Tale. 357 

JFlo. My prettieft PerdUa 
But, oh, the thorns we ftand upon ! CamUbf 
ftcfcrvcr of my father, now of me ; 
The medicine of our Houfe ! how (hall we do ? 
Wc are not furni(h*d like Bohemia'^ fon. 
Nor ihall appear in Sicily 

Cam. My lord. 
Fear none of this : I think, you know, my fortunes 
Do ail lye there : it (ball be fo my care 
To have you royally appointed, as if 
The Scene, you play, were mine. For inftance. Sir, 
That you may know youfhall not want i one word.— - 

[flcy talk aftde. 

SCENE X. 

Enter Autolicus. 

Aut. Ha, ha, what a fool Honefty is ! and Trufl:, 
his fworn brother, a very iimple gentleman ! I have 
fold all my trumpery \ not a counterfeit ftone, not a 
ribbon, glafs, pomander, browcfa, uble-book, ballad, 
knife, tape, glove, (hoe-tye, bracelet, horn- ring to 
keep my Pack from fadinjg : they throng who Ihould 
buy firft, as if my trinkets had been hallowed, and 
brought a benedidion to the buyer ; by which means^ 
I faw whofe purle was bed in picture ^ and what I 
faw, to my good ufe, I remembered. My good 
Clown (who wants but (bmething to* be a reafonable 
man) grew fo in love with the wenches fong, that he 
would not ftir his pettitoes *till he had both tune and 
words ; which fo drew the reft of the herd to me, that 
all their other fenfes ftuck in ears ; you might have 
pinch'd a placket, it was fenfelcfs ; 'cwas nothing to 
geld a codpiece of a purie; I would have filed keys 
oflF, that hung in chains: no hearing, no feeling, but 
my Sir's fong, and admiring the nothing of it. So . 

that in this time of lethargy, I pickM and cut moft \ 

A a 3 of 



358 1^ WlNTUR'/ Talb^ 

of their feftival puHes: tnd had not the old min cotnt 
in with a whoo-bub ag^inft his daughter and the 
King's fon, and fcar*d my choughs from the chaff, 
I had not left a purfe alive in the whole «rmy« 

[Camilloy Flor. and Perd.> £imefarward. 
Cam. Nay; but my letters by tbi^ means beifig 
there. 
So Ibon as yott arrivei Ihall clear that Doubts 
Flor. And thofe tbiU ybU'Jl procure from King i> 

Cam. Shall latisfie your father. 

Per. Happy be you ! ^-^- i 

All that you fpeak fliews fair* 

Cam. Who have we here? [S^ng.AxHUA. 

We*ll make an inftruttient of this ; omit 
Nothing may give us aid» 

jiut. If they have over-heard me now : why , hanging. 

Cam. How now, good lelio^, 
• Why (hak'ft thou fo f fear not, matt. 
Here's no hafm intended to thee. 

jht. I am a poor fellow. Sin 

Cam. Wby, be fb ftUI i hei^'ii to bedi^ «riU Aeal 
That from thee ; yet for the outfide of thy povettyi 
we mu(i tonkt an exchange ; therefore difeue thee hh 
ftantly : (thou muft think, there's neoeffity in^t) aoi 
change garments with this gentleman : tho' the penny- 
worth, on his fidej be the worft, yethoMl thee^ thofi 

feme boot. 

— . .... 

^ttt. 1 am a poor fellow, Sir^ (I know yc #eH 
enough.) ,, :^ 

Cam. ifjifi pr*ythee, di^patch: the gentleman is 
hatr Head already. ^ *> 

Jut. Are you in earneft, Sir ? (I fitoell the tridt 
on*t.)- 

Bq. Difpatch^ I pr'yriMe. 

Jut. 



Jfc* WinterV Tali. 359 

jbiL Indeed, I have had Earneft, but I cannot wkh 
confcience take it. 

Cam. Unbuckle, unbuckle. 
Fortunate Miftrcfs ! (let my Prophecy 
Come home to ye,) you muft retire yourfclf 
Into fomc covert j take your fweet-heart*s hat. 
And pluck it o'er your brows ; muffle your face, - 
Difmantle you ; and, as you can, difliken 
The truth of your own Seeming i that you may 
(For I do fear eyes over you) to ihip-board 
Get undefcry'd. 

Per. I fee, the Play fo lyes, 
That I muft bear a Part. 

Ctfw. No remedy—— 
Have you done there ? 

Bq. Should I now meet my father. 
He would not call me Ton. 

Cam. Nay, you (hall have no hat : 
Cbnoe, lady, come : fanswel, n^ firimd. 

Jut. Adieu, Sir. 

Flo. O Perdita^ what ha^e we twain forgot ? 
Pray you, a word. 
::^^Vam: Wtikt I do next, (hall be to tdl the King 

6f ^hh Blciaj^ and «4ut&e^'4bey are boufid : 
*- Wlksf^in^ fj}y- hope^is, I fiiat) Jb pr^ail 
tJPo foitc him after i in wfaofe company' - 
I Qiail review '^uUia\ fbr whoft fight ' 
1 have a woman^s Longing. 

PU. Fdt«urte fpeed iftl > i 
Thus we fet on, CamiUo^ to th* fea*fide. 

££ia^ Flor. wW Fer. 

Cam. The fwifter fpeed, the better. [Exk^ 

SCENE XL- 

Jut. I undcrftand the bafmefs, I hear it: to have 
an open ear, a quick eye, and a nimble hand, is ne- 

A a 4 ceflary 



360 The WinterV Tale. 

cefiary for a cut*pisrfe | a goofd nofe is requtfite a!(b, 
CO fmell out work for ch* other fenfes. 1 ree» this is 
the time that the unjuf! man doth thrive. '\Vha^^an 
exchange had this been, without boot ? what a \f6ot is 
here, widi this exchange ? fure, the GoAi do this year 
connive at us, and we Dlay do any thing eMefr^re. 
The Prince hmfclf is about a piece of miquity ;: ftcal- 
ing away from his father, with his dogjaornis h&is. 
{a) If r thought it were not a piece df hondly to ac- 
quaint th^ King witbai;* I would diftY I h^ld it the 
more knavery to conqeal n ; and chotein am 1 con^ 
ftant to my Profeifion. 

.. Enter Clo^fl and Shiplmd. . 

Afidf^ v^idc,^^— iierc*a more (saceer for -a hot braifi 1 
ever jr h^% end, every fiiap, church, feffioo*) hangii^ 
yiiddstftRcaceful tnan work. 

CoL See, fee ; what a man you are now! tbcve 19 
no other way, but to tell die King (he's a Changling, 
and'^imie!df your fleihand blood* 

Sbip,\ Nay, but bear me. 

•C/t7. N^, but heal" mq. . t • 

Clo. She being none of your fkfli aid biopd,^ yauD 
flefh and/blood hasnot oJScnded the 1Q|V % ' and^'^fo, 
your fle& and blood istiot to be |>anK£'d jby hifii 
Shew thofe tliii^ yoQ fomKL^about lBQf,;^tlk>fe\ftcrct 
things, all hot what fiio<ha8 with her vihidtiJiAigidtoc, 
let th^ law go whiftleiLMBakiiiDt yo»ii irn u:^i' 'K -^ 

Sbepk I v^U tell the King id{,Tvery'i|Gp«fc( yat^isai 
his foA^s pranks too; ^.^ 'HdAo; 1 may&y^^is na hondt 
** man neither to his&tiher^ oor coisnc^/t^iga about 
^* to make me the Kifigfaixrother-imiaml*' 

Clo. ♦' Indeed, brother-rin-law was the fartheft off 
^* you could have been to htm ; and ll1«i Vour blood 

(a) Oxford Edition -^-^Vulg.* If I thought it ^ir$ mfi$€$ tfha^tfy 
$9 acquaint fbt King jwitifaL I ^vch/4 not do it, 

. ♦« had 



The WinterV Tale.^ 361 

^ had been the dearer by I know how much an 
** onncc/'* •. 

jtia. Very wifely, puppies ! l4fiJe. 

Ship. WeU \ let us to the King.; there is That in 
this Fattlu^l will >nake him fcrafdi his beard. 

J$ii. rknow not» what ionpedt men t this Comphunt 
may be to che flight of my nwer, 

Od. /Pray hemily, he be u the Palace. 

Aui. Tho* I am not naturally hoinefi, I am fo 
ibmetf mte by chance : kt me podcet up my Pedler'a 
excremem. How now> ruftiqueSt whither are you 
bound? 

Step. To th^ Palace, an it like your Worfhip. 

Aut. Your a£&irs theie, what, with whM)m, the 
condkian^ of that farthel^ the place of your dwelling, 
your names, your ag^, of what having, breeding, 
and any thing that is fitting for to be known, du^ 
cover, ' • ' t « ' I 

Qo. Wd are but plain fellows, Sfa*. 

Aut. A lie ; you are rough and haiiy ; let me have, 
no lyin^ ; it becomes none but tradeimeo, and diey 
often give us Ibldiers the lie ; but we pay them fer . 
it with ftamped coin, not ftabbing fteel, ' t h e r e fore 
they do give as thb fie. 

. CU. Your Worlbip had like to have given us one, 
if you had notta^en your lelf with the manner. 

Sbif. Are you a Courtier, an like you, Sirf 

Ai^. Whedier it like me, or no^ I am a Courtier^ 
Seeft thou not the air ofthcOourt in thefe enfoldings I 
hath nor oky gate in it the meafune of the Court P re- 
ceives not thy nofe coiirt^odour from me ? refleft I 
Aot, on thy bafenefs, court*oontempt ? tbink'ft thou, 
for that I inlinuate, or toze from thee thy bufinefs, I 

9 ThirtfiriihefJ9iiKAgP9iusih^iU-'\ i>#Xr t]ie negative : the 
fiihle requires it. Tlie Joke it diis» they have a profit in lying to 
OS. by aa?aociog the price of thair commodtties i therefore they 
ddJie. 

am 



j6a '^ WimterV Tals. 

am tborefore no CDortier? I am ceurtier, Cap^pii 
and one that vtU either puih on, or pludc back thy. 
bufinc&tbeie; whereupon I oommaiid thee «o open 
thjr s^air. 

Ship. Mv buGncfs* Sir, is to the King. 

jt0h What Advocate haft thou to him ? 

Sbep. I know not, an*c like you. 

Clo. ' Advoate's the court^wonl finr a phcaiatt i 
&y, you have none. 

^bef. None, Sir ; I have no oheafant cock, nor hen. 

Juti f^ How Ue&M are.we, tnat are not fimplexnen I 
^ Yet Nature might hive made me as theft are, 
^ TherefoK I wiU not difilain/* 

Cb. This cannot be but a^reat Courtier. ^ 

Ship. His garments are rich, but he wears them 
HOC handibmly. 

Cla^ ^^ Ha feems to be the ttiore nbbte^ in being 
u Cutaftiad i a Great mdn, I'll waiiant 1 1 know, by 
^ die pckk« oofs teeth." 

jMt. Ths mrthel there ? what's Tth'^chd ? 
Wbcrefiarethatborl^ 

St^.Sk^ there Ives fuch Ikrets in this farchd and 
faoi^ which none mud: know but the ICing ; and which 
be fiialKknow within this hour, if I may come to th* 
ijpeechxifiiim.. 

Aa. Age; thou halt loft thy labour^ 

Sbep..Whv^SiTf . 

jlut. The Kiag is not at the Palace ; he is gone 
ahcard anew ihqprCopufige melancholy and air bim* 
^f ; for if thou be'ft ca{^te of things ferious, thou 
muft know^ the ICing is full of grielT 

Sbip^ So 'tis iaidi Sir, about bis fon that fhould 
have married a ihq>herd's daughter. 



tk bribery of oMinsi soft aafie^iiaft. 



Tie VimtbrV Talb« 36^ 

Aiu. If thti Aolisrd be not ki hiiMl4Bft) lot faim 
§f.% thecurfesbc fiiall havt^d^fivtiiMshe flail fo^^ 
wihbn^ cbe bade of aMa» ijiq heiit #f oiODfter. ' 

Cio. Think you fo. Sir ? j 

jtuL Not be fdone ihall ftifliir whtft wit am o^ke 
heavy, and veageance bitter % but tho6 that are gpr« 
mane to him, too' jeokov'd 66/ tkncti ^1 aU come 
under the hangman » whurh tho* it be great jKtyf yet it; 
is neceflbry. An old Shee{>«whiftling^WgMei a ram- 
tender, toiofo 10 have Ilia dau^ter ootQo ioio flraoel 
fcoae fay, he fliaU be fipi^ti ^ btic thaft death ia coo 
foft for him^ fay I: dmw trar <lmNie'ktoaifaB0|M^ 
all deaths are coo few, the lhii|Mft too eafiei 

Ch. Haa «he old maa e'er « faoy Siri do yooiMr^ 
asi*^ like joui^ Sir? 

Aut. He haa a fon, who ihaU be flay*d affve^ thai 
'nouHed over witbibocieyv ftt od the bead of a wUjft'a 
neft, then ftand 'till he be three ijuantiytind a^ei<| 
dead ; then itcx)¥er'd again wieb .iS(i^ti#<a^3or Jbnd 
other bot itifofioo; then,, raw aa be m^ (ahd'tfttlrluM^ 
teftday prc^noftication proclaiiM) {h^'hebr'Al^ 
gainft a brick*wall, the SM lojphttgwitbftibQiM^d 
eye upon him, where he is K> bebold bim^ witb Aie$ 
blown to deatb. But what talk we of thefelttaiiorly 
ntfcais^ whole miferies are to be fmil'd u^ chdr ofiea* 
ces being ib capital? Tell mtf, (jfor yM feent cote ho* 
oefl plain men) what you have to the Kiagi ^bong 
fbmcthing gendy oonfider^d, I'Jl biiag yoa where be it 
aboardi tendee lour ferfboa eo bia prtftciee, wUlper 
him in; ^Dur bcfaftlf» &nd if it bU in min, befides Iht 
King to efieft your faks, bece ta a than IbtlL da k« 
. Q9i He feems ea be of gieat autbority i ^o^ wkh 
bim, give him gold; ^< and the^ authorky^ a ftttb* 
*^ bom Bear, yet he k oft led by the nofe witb g^d ('^ 
ihew the inficfe of yaar poffe to tke ouifide of hit 
band, and no more adO. Reastanbct, fton'd, and flay 'd 
attvfc' 

Ship* 



^64 3** WinterV Tale. 

Sbe^. An'c pfeafe yoOf Sir» CO undertake the bufiiicfi 
ibr us, here is that gold I have ; I'll make it as much 
more, and leave this young man in pawn 'till I bring 
k jou. 

' Aa. After I have done what I promifed ? 
Sbep. Ay, Sir. 

jtHt. Wdl, give me the moiety. Are you a party 
in this bufinefs? 

Clo. '^ In fome fort, Sir; but tho'. my cafe be a pi- 
^ tiful one, I hope I ihall not be flay*d out of it. 
' Ani.^O^f that's the: cafe of the ibq>herd's Ion; 
baiig hinn,' he'll be itiade an example. 

C%. Comfort, gcxxi nemfort; wemuft to the Ring, 
and fliew oiir ilrange fights ; he muft know, 'tis none 
of your dflughter, nor my fitter ; we are gone elfe» 
Sk^ I will give you as much as this o]d man does, 
when the bufinefs is performed ; and remain, as he 
£kys, your Pawn *iiU ft be brought you. 
* Jiit* I will truft you^ walk before toward the fea- 
fide, go on the right hand ; 1 will but look upon the 
hedge and follow you. 

Qo. We are bleis*d in this man, as I may fay, even 
bkfs'd. 

Sbep. Let's before, as he bids ui; he was provkied 
to do us good. tEscidM Sb^. and Clown. 

AM. Ifl had a mind to be . honeft, I fee, Forimu 
woukl not fufier me } flie drops booties in my mouth. 
1 am courted now with a double oocafion : gpld, and 
a means to do the Prince my mafter good ; which, 
who knows how That may turn back to my ad- 
vancement ? I will bring thefe two moles, thefe blind 
ones, aboard him ; if he think it fit to ihoar them a- 
gain, and that the complaint they have to the King 
concerns htm nothing, let him otll me rogue, for be- 
ing fe far officicms ; for I am proof againft that Title, 
and what fliame elfe belongs to't : to him will I pre- 
ient them, there may be matter in it. VExiL 

ACT 



rbe WiNTBK^ TxtB. 365 



f » 



ACT V. S C E N P * L 

Changes to S i c i l i a. , 



Enter Leontes, Cleomines, Dion, Paulipa, and 

Servants. 

. CtEQMIKfS. 

SI R, yoa have done enough, and bare perfor^^^ 
A faint-like fprrow : no *fuk could you irUkft 
Which ^ou have- not red^ow^d y indocd^ paid dowa 
More penitence, than done tr^fpais. At the Jafi^ 
Do as the heavens have done, fcvget your evil i 
With them, forgive yout*lfc • 

Leo. Whiift 1 remember • * > 

Her and her virtues,^ I cannot forget ., 

My blemiifaes in them, and fo'^iU €faink.«f i 
The wrong I did myfdf ; which was (o moA^ « 
That heir-lefs it bath made my JCingdom^ aod 
DcftroyM the fw<et*ft condpanion, that ci'cr msfk 
Bred his hopes out of. ^ « >: 

Pau, True, toatrue, my terd% . . - 

If one by on* yotr wedded all the worlds 
Or, from thd All that are, took fomething ^ood't 
To make a perfeft woman |(he^ you kin*d« 
Would be unparallePd. •: 

Le0. I think fo. KlllMf " ^ • 
Kill'd? Ihe 1 killM? I didfo, but rfiou ftrik'ft me 
Sorely, to fay I did ; it ifrttSibvtMr 
Upon thy tongue, as in my thoight. Now, good now» 
Sayfo but ferddm. • 

Cle. Not at al>, good lady 1 
You might have fpokea thdufand ihifigSy that would 
Have done f be time mol^e bMefit, and'gratt'4 v 
Your kindncfs better. 

Pan. 



^ 



366 ^ WnkTiKfi TacH^ 

Pm. Yoa are one of Af^ 
[Would Hyt him ved Mfpin* 

Dh. If you would not £>» 
Tou pity noc.the flntC) aor die lemaub r i noe 
Of his moft fovere^ names confidcr Ihtk^ 
What dangers (by ms btghnefiT iail of ifliie) 
May drop upon his^kingdom^ and devour 
Incertain lookers on« What were more holy^ 
' Than to rgoice the former Qneen ? This wilL 
What holier, than foe royalty's repair. 
For prefent comfort^ ada hr fbcme gMd^ 
To blefi the bed of Majefty again 
With a fweet leilow tsM 

Pan. There is none worthy, 
Refpefting her rtwA ^one; bcfides, the Gods 
Will have fulfiird their fecret jiiirpofts : 
For has not the divine jlpcih laid, 
Is*t not the tenour of his oracle, 
That King LmtttJ (hall not hi»re uilieir, 
"Till hb loft child be found? wkich^ that it ffaall» * 
Is all as monftrousto our human re^oh^ - 

I nan io nJQici^ thifirmtn f^tin 1 8 wB tiFj Thefpeakcr b 
here ^ving reafont why the King flKwld narBy agpn, Om rokfeo 
hf jMty to the Statei aiakiry te^afi 10 the«mtia9U|4e of the royal 
ftnuly I and the $hird^ cpmfoMt and oonljirfaiioii to the Kti^*s af- 
flidioD. All hitherto is plaip, and becoming a tmy-oounCdipi' 
JBut now comes in, what he caMs, a b§fy argument for it, and that 
18 a rtjming thai tht f$rm$r ^mm- it ^wtU mni at rtft* To make 
this argoment of force, we muft condaJe thacthe fpeaker went 
npon thb opinion, that a wid<|wer qin never hotftily rgoice that 
hjs former wife is at reftj till ie has gpt another. Without ^u^ 
ShaktJ^ar wrote, 

■ inat'^tr^jifti hofyt 
7batt to rAice ib^j^rtaer ^$A» f Tms «ltL. 
What, fays the fpeaker; can be a more holy mocine (0 a otv 
chdce than that it will glad the fpirit of the former Qgeen? ior 
ihe was of fo excellent a diipoiition that the happineis of the Kj&g 
and Kingdom, to be procuced by it, will give her extreme |lea« 
fore. The Poet goes npon the geseml opifiioo, that the ipkiia of 
the happy in the other world are concerneii ifar the o^ndilki^ of 
chrir furviying friends* 

As 



the W 4 N T B R*Jr T A 1 1. 367 

As my Antigmis %o break Ui ginve^ 
And come zg^an to mt ii who, qn oiy lifi% 
Did pcrUh with the infant, ^is j^oar coiw^ 
My lord Ihould to the heaV*ns bt contrary i 
Oppoie againft thctr wiUs.—C^ not ibr iSiic ; 

The crown will find an heir. <Sreat Ale^twder 
Left his to th' wortbicft; fo hU fuweflbr 
Was like to be the beft. 

Leo. Good PatUna^ 
Who haft the xnemonr of Hermkwt,^ 
I know, in honour : Q, that ever T ^ 

Had fi}iiarM roe to thy counfeL! then, v^tsg^ now 
I might have looked upon my Queea*a "MX eyi^ 
Have taken treafure uom her Iipi! 

Pm. And left ihem 
More rich, for what they yielded* 

Lto^ Thou fpcik*ft troth < 
No more fuch wives, tha«fore no wHe ; onie ivnHE^ 
And better us^d, would msdte her fiinted ipkic ^ 
Again pofleft her corpsi and on thi$ ftagi^ 
<" Where- we {a) oflfend her now) appear foid*vQX(^ 
And begin. Why to me ? — — 

Pau. Had (he fudi power, 
Sbe had juft Caufe. 

Leo. She had) and wouU incenie me 
To murder her I imrrisd. 

Pau. I fbould fo : 
Were I the ghoft fb«t walked, Pd bid yocr mirit 
Her eyo^ and t^ me, for what dull pave in'c 
You chofe her ; then INI flmdc, riwt even your «avi 
ShouM rift to hear me, and the words that follewM 
Should be. Remember mine. 

Leo. Stars, ftars. 
And all eyes elfe, dbid coals: ftor ^ou no wife : • 
I'll have no wifir, Pmiina, 

l{a) offend her. Mr. TfaeobaJd— ^Vttlg. 9findm^ 

Pau. 



368 Tie WiNTiaV Talm. 

Pom. Will you fwctr 
Never to marry, but by my free leave? 

Li9. Never, Paulina ^ {o be blelsM my fplrit f 

Pam. Theih good my Jords, bear witaefi to hisoadu 

Cbo. Too tempt bim over*much. 

Pau. Uolefi another. 
As like Hermme as is her pifture. 
Affront his eye. 

Clio. Good Madam, prav, have done* 

Pa». Yet, if my lord will marry ; if you will. Sir 1 
No remedy, but you will \ give me the office 
To dide you a Qieen \ (he inall not be lb young 
As was yoiy ibrnoer ^ but ihe (hall be fuch. 
As, walked your firft Queen's gho(t, it (hould take joy 
To fee her in your arms. 

Leo. My true PauUna^ 
We (hall not marry, *till thou bid'ft us. 

Pau. That 
Shall be, when your firft Queen's again in breath : 
Never till then. 



it 



SCENE n. 

Enter a Gentleman. 
Gei^. One that gives out himfdf prince Fbrbui^ 



Sopi of, P^tnenes^ with his pinoefs (flic, 
The fautft I have yet beheld) defires accefi 
To ysxor Jiigh jsrefeooe. 

Z>^M..¥inba£ with him? he comes not 
Like to bis &ther*s greathefs ; his approach, 
Sooiib«f jWraoAaoQC'Md fudden, tdb us, 
'Tis not a vifitttion IbmM, but forc'd 
By need mi accident. What train? 

Gent. But few. 
And thofe biit; mcMu 

JJo. His princefs, &y you, with him ? 

Gent. 



The WinterVTali. 369 

Gent. Yes % the mod peeflefs piece of earthy I think^ 
That e*er the fun fhone bright on. 

Fau. Oh Hermione^ 
As every pfeient time doth boaft itfelf 
Above a better, gone ; * fo mufl; thy grave 
Give way to what's fccn now. Sir, you yourlelf 
Have faid, and writ fo ; but your writing now 
Is colder than that theme ; Jbe bad not been^ 
Nor was Jbe t6 he equalled \ thus your verfc 
Flow'd with her beauty once \ 'tis ftxrcwdly ebb*d. 
To fay, you've fcen a better, 

Gent. Pardon, Madam ; 
The one I have almoft forgot, (your pardon) 
T,h« other, when fhe has wtain'd your eye, 
Will have your tongue too. This is a creature. 
Would flie begin a fed, mig^t quench the zeal 
Of all profeflbrs elfe, make profelites 
Of who fhe but bid follow. 
Pau. How? not women? 
Gent. Women will love her^ that fhe is a woman 
More worth than any man : men^ that fhe is 
The rarefl of all women. 

JJo. Go, Cleominesi . 
Yourfelf (affiftcd with yoor hondur^d friends) 
Brins them to our cmbracoBnrat.- Sf til ^cis ftrange 
He thus fhould fteal upon oi* . (^Bxit CIco. 

Pau. Had oar prince 
(Jewel of children) feen this hooTf he had paiv*4 
Well with this lord ^ there was ik% full a -month* 
Between thek fcarths* - • - > 

Leo. Pr*ythce» no more; caafev <lMI IttiDi^fl^ 
He dies to me again, when taik'd <rf^r fure. 
When I fhail fee this gentleman, tbjr Iptechci 
Will bring me to confider that which may 
Unfurnifh me of reafon. They are come. 

2 ^--^^^Jo mmjl tiygravf] Gramt for Epiiupb. 

Vol. III. Bb SCENE 



370 1^^ Winter'^ Talk,. 

SCENE nL 

Enter Florizel, Perdita, Cleoimtio, Md ctben* 

Your mother was moft true to wedlock, prince. 
For ffie did print your royal father off. 
Conceiving you. Were i but twenty one, ' 
Your father^s image is fo hit in you, 
His very air, that I fliould call you brother. 
As I dia him, and fpeak of fomething wildly 
By us performed before. * Moft dearly welcome. 
As your fair princefs, goddefs! — oh! alas! 
I loft a couple, that 'twixt heav'n and earth 
Might thus have ftood begetting wonder, as 
You gracious couple do ; and then Ilcft 
(All mine own folly ! ) the fociety. 
Amity too of your brave father, whom 
(Tho* bearing mifery) I defire my life 
Once more to look on. 

Flo. Sir, by his command * 

Have I here touch'd Sicilia^ and from him 
Give you all greetings, that a King, (at friend) 
Can fend his brother ; and but infirmity, ' 
Which waits upon worn times, hath fomething ^iz^d 
His wifli'd ability, he had himfelf 
The lands and waters 'twixt your thronfe and \ih 
Meafur'd, to look upon you ; whom he loi>ds,' 
He bad me fay fo, more than all the fcepters. 
And thofe that bear them living. 

Leo. Oh, my brother! 
Good gentleman, the wrongs I have done thee ftir 
Afrefh within me ; and thefe thy offices. 
So rarely kind, are as interpreters 
Of my behind-hand flacknefs. Welcome hjdier^ 
As is the Ibring to th' earth. And hath he too 
ExposM this paragon to th* fcarAil ulage 

i - (At 



Ihe Winter*/ TALBt 371 

(At leaft, ungentle) of the dreadful Neptune^ 
To greet a mao^ not worth her pains; much Icfs, 
Th* adventure of her perfon ? 

Fh. Good mj lord. 
She came from Libya. 

Leo. Where the warlike Smalus^ 
That noble honoured lord, is fear*d, and lo?*d ? 

Fh. Moft royal Sir, 
From thence \ from him, whofe daughter 
His tears proclaimed his parting with her ; thence 
(A profperous fouth-wind friendly) we have crofs^djj 
To execute the charge my father gave mc. 
For vifiting your highncfs ; my bcft train 
I have from your Sicilian (hores difmifs'd. 
Who for Bohemia bend, to GgniBe 
Not only my fucccfi. in lAhya^ Sir, 
Bat my arrival, and my wife's, in fafety 
Here, where we are, 

Leo. The bleflcd Gods 
Purge all infedion from our air, whilil you 
Do climate iiere I You have a holy father, 
A graceful gentleman, againft whofe perfon. 
So iacred as it is, I have done fin s 
For which the heavens, taking angry note. 
Have left me iflue-lefs ; and your father's ble&M| 
As he from heaven merits it, with you, 
Worthy his goodnefs. What might I have been. 
Might I a fon and daughter now have look'd ouj 
Such goodly things as you ? 

SCENE IV. 

Enter a Lord. 

Lord. Moft noble Sir, 
That, which I fhall report, will bear no crcditt 
Were not the proof fo high, Pleaie you, great Sir,' 

B b 2 Bohemia 



372 The Winter'j TalsJ 

Bohemia greets you from himfelf> by me } 

Dcfires you to attach his Ton, who has, 

His dignity and duty both caft off, 

Fled from his father, from his hopes, and with 

A ihephcrd*s daughter. 

Leo. Where's Bohemia ? fpeak. 
Lord. Here in your city y I now c^me from him. 
I fpeak amazedly, and it becoqties 
My marvel, and my mefTage : to your court 
Whilft he was haftning, in the chafe, it feems^ 
Of this fair couple, meets he on the way 
The father of this leerning lady, and 
Her brother, having both their country quitted 
With this young Prince. 

Flo. Camillo has betrayed me ; 
Whofe honour and whofe honefty Yill now 
Endur'd all weathers. 

Lord. Lay't fo to his charge ; 
He's with the king your father. 
Leo. Who? Camillo? 

Lord. CamillOj Sir, I fpake with him ; who now 
Has theie poor men in queftion. Never faw I 
Wretches lo quake ; they kneel, they kifs the earth ; 
Forfwear themfelves, as often as they fpeak: 
Bohemia (lops his ears, and threatens them 
With divers deaths, in death. 
Per. Oh, my poor father ! 
The heav'n fets fpies upon us» will not have 
Our contraft celebrated. 
Ijeo. You are marry'd ? 
Fh. We are not. Sir, nor are we like to hc^ 
The ftars, I fee, will kifs the valleys firft^ 
The odds for high and low's alike. 

Leo. My lord. 
Is this the daughter of a King? 

Flo. She is. 
When once fhe is my wife. 



Tie WinterV Tale. 373 

Is^o. That once, I fee, by your good father's fpeed. 
Will come on very Qowly. I am lorry, 
(Moft forry) you have broken from his liking; 
Where you were tyM in duty ; and as forry, 
' Your choice is not fo rich in birth as beauty, 
That you might well enjoy her. 

Flo. Dear, look up ; 
Though Fortune^ vifiblc an enemy. 
Should chafe us, with my father-, power no jot 
Hath flie to change our loves. 'Befeech you, Sir, 
Remember, fince you ow'd no more to time 
Than I do now; with thought of fuch afIe<5lions. 
Step forth mine advocate ; at your requell, 
My father will grant precious things, as triSes. 

Leo. Would he do to, Td beg your precious miftrefi^ 
Which he counts but a trifle. 

Pm. Sir, my li^e. 
Your eye hath too much youth in*t ; not a month 
•Fore your Queen dy*d, (he was more worth fuch gazes 
Than what you look on now. 

Leo. I thought of her. 
Even in theft looks I made — But your petition 

{To Florizcl. 
Is yet unanfwcrM ; I will to your father ; 
Your honour not overthrown by your defires, 
I'm friend to them and yQU ; upon which errand 
I now go toward him, therefore follow me. 
And mark what way I make : come, good my lord. 

\ExeuM. 

3 Tour chnci is not fi rich in woiTB at Beantjf,'} The PoeC 
moft bave wrote* 

Tour cboico is notfi rich in biktu as bemtsty i 
Becaofe Leomes was fo kx from difparaging, or thinking meanly 
of her worth, that, on the contxary, he radher efteems her a trca* 
fare j and, in his next fpeech to the Prince, calls her his fntiout 

Bb3 SCENE 



374 ^^^ VV I N T E rV Tali* 

SCENE 

TSlear the Court in Sicilia. 

Enttr Autolicus, and a Gentleman. 

4ut. 15 Efccch you. Sir, were you prcfent at diis re- 
J3 lation ? 

I Gent, I was bv at the opening of the iarthel, heard 
the old Ihq^herd aelhrer the manner how he foond k & 
whereupon, after a little amazedneis, we were all com- 
tnanded out of the chamber : only this, methoughc, I 
heard the ihepherd fay, he found the child. 

4ut. I would moft gladly know the ilTue bf it. 

1 Gent. I make a broken deliverv of the bulidels; 
But the changes I jperceived in the King, and CamUhy 
were very notes ot admiration ; they feemM aln^ft, 
with ^ring on one another, to tear the cafes of €txat 
fycs. There was fpeech in their dumbnefi, laogaage 
in their very gefture ; they looked, as they bad faeaVd 
of a world ranfom'd, or one deftroy'd ; a notable paA 
fion of wonder appeared in them ; but the wifeft b^ 
holder, that knew no more but feeing, could not fiy 
if th* importance were joy or forrow •; but in the et* 
tremity of (he one, it muft needs be. 

jjEnter another Gentleman. 

Here comes a gentleman, that, happily, know4 more: 
the new^, jR^^<fr(? ? 

2 Gent. Nothing but bonfires : the oracle h ftilfillM ; 
d)e King's daughter is founds foch a deal ef wtindtt 
is broken out within this hour, that balladns^akers 
pot bp able to exprcfs it. 

Enter anptber Gentleman. 

Here conies the lady Paklina*% Steward, he cafl 
liver you more. How goes it. now^ Sxsl this iiewt» 

whicb 



TJbe Winter'/ Talb. 375 

wbidi h callM true, is fo like an old tale, thit the 
verity of it is in ftrong fuipicion $ has the King found 
his heir? 

3 Gent. Moft true, if e^er truth were pregnant by 
circumftance : That which you hear, you'll fwear you 
foe, there is foch unity in the proofs. The noantieof 
Quoea Hirpoffue — her jewel alxMit the neck oi it— ^ 
the letters ofAntigoms found wkh it, which they know 
jto be his cbaradcr, — the niajefty of the creature^ ki 
re&oiblance of the mother, — the aflirdkion of noble- 
ness, wkich nature fhews above her breeding, -*-* and 
many other evidences proclaim her with all certainty 
10 be the Kind's daughter. Did you fee the meeting 
of the two Kings ? 
^: 2 Gent. No. 

3 Genl. Then have you loft a fight, which was to be 
ficn, .cannot be fpoken of. There might you have 
i)eh£ld one joy crowji another, fo and in fuch manner, 
that it feem'd, forrow wept to take leave of them, for 
cheir joy waded in tears. Tiiere was cafting up of 
c^es, holding up of hands, with countenance of fuch 
diulraifiion, that they were to be known by gannent, 
not by &vour. Our King being ready to leap out of 
himioif, for joy of his found daughter ; as if chat ]oy 
were now become a lofs, cries, oh, thy mother, thy 
fliother I then asks Bohemia forgivenefs ; then embraces 
his fon-in-law ; then again worries he his daughter, 
with clipping her. Now he thanks the old ihepherd, 
who ftands by, ^' like a weather-^beaten . conduit of 
^^ many Kings* reigns/' I never heard of iiich another 
encounter, which lames report to follow it, and un^ 
does deicription to do k. 

2 Gen$. What, pray you, bccanoe of An^enus^ that 
carry'd hence the child ? 

3 Gent. Like an old tale^ftiU, which will have mat- 
ters to rehearie> tho' credit be afleep, and not an ear 
open i he was torn to piec»» with a bear 1 this avouches 

Bb 4 the 



376 The Winter'^ Tale. 

the fliepherd*s lba> who has not only his innocence, 
which ieeiiis mucb^ tp juftifie him, but a handkerchief 
and rings of his^. iha( Paulina knows. 

1 Geni. Wbac became of his bark, and his fol- 
lowers ? 

3 Genl* Wreckt the fame inftant of their maftet's 
death, and in the view of the (hepherd ; fo that all 
the inftruments, which aided to expoie the chiki, 
were even then loft, when it was found. Bur, ob, 
the noble combat, that *twixt joy and fbrrow wa 
fought in Padina I She had one eye declined for the 
lofs of her husband, another elevaiied that the Orade 
wa$ fulgird. She lifted the Frincefe from the eanh, 
and fo locks her in embracing, as if ihe would pia 
her to her hearty that flie might no more be in danger 
af, lofiog^ 

, I G^fd. The dignity of this ad was worth the au- 
dience of Kings and Princes \ ior by fuch was it 

*apd. 

iGent. One of the pretcieft touches of all, and^hat 
^ which angled for mine eyes» was, when at the reb- 
tion of the Queen's death, with the manner liow ihe 
catne to it, bravely confefs'd, and lamented by the 
King, hqw attentiveaefs wounded his daughter ^ .^dll, 
from oi;ie fign of dolour to another, flic did^witlLan, 
4/1}^ /• j( would fain fay, bleed tears; for, I am fore, 
my heart wept blood. Who was moil: marble, there 
changed eolour •, fome fwooned, all forrowed j tf all 
the world could have feen*r, the woe had been uoi- 
, iverfaL . '• 

I Genu Arc they rettir ned to the court ? 

3 Gent. No. The Pifincefs hearing of her mother^ 
Aatue, v^hich is in ;bc keeping QiJ^auUna^ a /piece 

nvoiy &t ] I dare prpnoance what ib here in hooks, a moft fiup^ 
. incerptlationofisme playerydiat angled for i^rittfdfm; smd there- 
fore have ftrock it ouc of the text. 

many 



The Winter'j Talb. 377 

many jeara "m daingv and now newly p^rormM by 
^ tbit tsm.kdian imfter, yulk R9man9i who, had 
he himfelf etemicy, and could pat breath into his 
work, woold beguile nature of her €ufiom> Co per- 
fectly he is her ape : He fo near to Hermione hath done 
Heramm^tiM. they fay, one would fpeak to her, and 
fiand in hope of aafwer : Thither with all greedinefs 
of afie&ioQ are they gone, and there they intend to 
fop. 

- 2 Gmis I thought, (he had fome great matter there 
in hand, for ffae hath privately twice or thrice a-day, 
erer'fince the death of Hermimei vifited th^ removed 
hooie. Shall we thither, and with our company piece 
cbe rejoycing? * 

I GfttL Who would be thence, that has the benefit 
of accefs ? every wink of an eye, fome new grace will 
be bom ; our abience makes us unthrifty to oar know- 
ledge. Let's along. [Exeunt. 

Jut. Now, had I not the dafh of my former life in 
me, wouki preferment drop on my hestd. I brought 
the old man and bis fon aboard the Prince t toid him, 
yi heard them talk of a farchel, and I know not what; 
but he at that time, over-fond of the {hepherd*$ 
daughter, (fo be then took her to be) who b^n to 
he much fea*fick, and himfelf little better, extremity 
weather continuing, this myftery remained andif- 



j that rare Italian mafier^ Ju]id Romano i Cs^cJ Mr^,7Ifi$hoU 
lays. All the fncomiums put together^ that have heen conferred em 
this extille*t artifi in fainting and archite8urey do not amount 1 9 
the fine praife here given him Syeur Author, fiut he is ever the on- 
locicieft of ftll criticks whea ho-paffesjudgmenc on bcautio and de- 
feds. The padkge happens to be quite unworthy Shaktffear. i . He 
makes- hfs ipeakar fay, that was Julio Romano the God of Nature, 
he would outdo Natuie. For this is the plain meaning of the words* 
had he himfelf eternity^ and could put hreatb into bis tvork, he voouU 
hifftile Hatttre of her cuftofu, zdh. He makea of this fiimooi 
Painter, a Statuary i 1 fuppofe confounding him with Michael Aur 
gelo i but, what is word of all, a painter effieetuetf like Mrs. SaU 
of her wax'work. 

coveredi 



378 ^^ WinterV Ta lb. 

covertd. But 'tis all one Co me ; fer bad I fascn die 
finder out of this fecrer, it would not have rdifli'd 
among my other difcrtdim* 

S C E N E VI. 

Enter Shepherd and Clown. 

Here come thofe I have done good to againft xoy 
will, and already appearing in the bloiToms of tiieir 
foctune. 

Sbep^ Come, boy, I am pad more children ; but 
thy fojis and daughters will be ail gentlemen borii. 

do. ^^ You are well met, Sir y you denipd to figh{ 

with jpae this other day^ becaufe I w^ no gi^clsmao 

born : fee you thefe cloaths ? fay, you lee then) noc^ 
'^' and think me flill no gentleman born« You wc|:c 

befl lay, thefe robes are not gentlemen born. Give 

me the lie ; do, and try whether I am B9t how a 

gentleman born. 
. jlut^ I know you are now, Sir, a gentleman born; 
. .Clo, Ay, and have been fo any ucoe. theie four 
hours.. 
. . Shep. And fo have I, boy. 

CIo. So you have ; but I was a gentleman born be- 
fore my lather ; for the King's fon took me by the 
hand, and call'd me brother ; and then the two Kin^ 
^ird my father brother j and then the Prince my bro- 
fher, and the Princefs my fitter, call'd my father, fa- 
ther, and fo we wept ; ^^ and there was the firft gen- 
^* tleman*like tears that ever we ihed. 

Shep. We may live, fon, to (hed many more. 

Clo., AXf or clfc 'twere hard luck, being in fo pro- 
pofterous ettate as we are. 

Aut. I humbly befeech you. Sir, to pardon me all 
the faults I have committed to your worfhip, and to 
give me your good report to the Prij^ce^ my mafter. 

Sbcp^ 






4C 



The Winter*/ Tale. 379 

Sb^. *IV'ytheet fon, do ; for we muft be gently 
now we are gendemeD. 

Clo. Thou wik amend thy life i 

Aui. Ay, an ic like your good worfliip. 

Clo. Give me thy hand ; 1 will fwear to the Prioc^ 
thou art as honeft a true fellow as any is in Bobemis. 

Sbep. You may iay it, but not fwear it. 

Clo. Not fwear ic, now I am a gentleman? kt 
boors and franklins fay it, Til fwear it, 

Sbep. How if it be falie, fbn ? 

Clo. If it be ne'er fo falfe, a true gentleman xaxf 
fwear it in the behalf of his friend : and I*il fwear to 
the Prince, thou art a uU fellow of thy banda, and 
that thou wilt not be drunk ; but I know, thou art 09 
tall fellow of thy hands ; and that thou wilt be drunk i 
but I']]' fwear it ; and, I would, thou would*A be % 
tall fellow of thy hands. 

Aa. I will prove fo. Sir, to my power. 

Clo. Ay, by any means prove a tall fellow , if I 
do not wonder how thou dar'ft venture to be drunk, 
not being a tall fellow, truft me not. Hark, the Kir^ 
and the Princes, our kindred, are going to fee th^ 
Queen's pi^re. Come, follow us: we'll be thy 
good matters. {Exeunt. 

SCENE VII. 

Changes to Paulina'i Houfe. 

Enter Leontes, Polixenes, Florlzel, Perdita, Camillo, 
Paulina, Lords and Attendants. 

Leb./^ Grave and good Paulina^ the great comfort 
Vy That I have had of thee I 
Paid. What, fovereign Sir, 
I did not well, I meant well ■% all my fervice$ 
You have paid home. But that you have voucb&f 'd» 

With 



380 Tht Winter'/ Tale. 

^ith your crown*d brother, and thefe your contra<£l:ed 
Heirs of your kingdoms, my poor houfe to vilic i 
it is a furplus of your Grace, which never 
My life may laft to anfwer. 

2>^. O Paulina^ 
Wc honour you with trouble ; but we came 
To fee the ftatue of our Queen. Your gallery 
Have we pafs*d through, not without much content. 
In many ungularicies ; but we faw not 
That, which my daughter came to look upon. 
The ftatue of her mother, 

Paul. As flie livM peerlefs. 
So her dead likenefs, I do well believe^ 
Excels whatever yet you look*d upon. 
Or hand of man hath done ; * therefore I keep it 
Lovely, apart. But here it is ; prepare 
To fee the life as lively mock'd, as ever 
Still fleep mock'd death *, behold, and (ay, 'tis well ! 

[Paulina draws a curtain^ and difcovers 
Htrmionc Jianding like a ftatue^ 
I like your filence, it the more fliews off 
Your wonder ; but yet fpeak, firft you, my Liege^ 
Comes it not Ibmething near ? 

Leo. Her natural pofture ! 
Chide me, dear ftone, that I may fay, indcedg 
Thou art Hermione 5 or rather, tnou art (he. 
In thy not chiding i for (he was as tender 
As infancy and grace. But yet, Paulina^ 
Hermione was not fo much wrinkled, nothing 
So aged as this ieems. 

Pol. Oh, not by much. 

Paul. So much the more our carver'3 excellence^ ." -" 

6 — tberefire I keep it ' ' ' "\ 

^ Lovely, apart. '''^'] Lo^y^ i ^ cWily, wA moreihaQ 
ordinaiy P^od aod landerBefs, T)ie Qgcfird Editor rcadi^ * 

Leneijt apart. 
As if It coald be apart without being alone. 

Which 



The WinterV Tale. 381 

Which lets go by fomc fixteen years i and makes her» 
As (he liv'd now. 

L^o, As now (he might have done. 
So much to my good comfort, as it is 
Now piercing to my ibuL Oh, thus fhe ftood ; 
!Even with fuch life of Majefty, (warm life. 
As now it coldly (lands) when firft I woo'd her, 
I am a(ham*d ; do's not the fione rebuke me. 
For being more {lone than itP oh, royal piece ! 
There*s magick in thy Majefty, whicn has 
My evils conjur'd to remembrance *, and 
From my admiring daughter took the ipirits. 
Standing like (lone with thee. 

Per. And give mc leave. 
And do not fay ^tis fuperftition, that 
I kneel, and then implore her bleffing.— Lady^ 
Dear Queen, that ended when I but began. 
Give me that hand of yours to kifs, 

Paul. O, patience 3 — 
The (latue is but newly fix'd y the colour's 
Not dry. 

Cam. My Lord, your (brrow was too fore laid on. 
Which iizteen winters cannot blow away. 
So many fummers dry : (carce any joy 
Did ever fo long live i no ibrrow. 
But kiird itfelf much fooner. 

PqL Dear my brother, 
Let him, that was the cauie of this, have power 
To take off fo much grief from you, as he 
Will piece up in himfclf. 

Paul. Indeed, my Lord, 
If I had thought, die light of «my poor image 
Would thus have wrought you, (for the (lone is mine,) 
rd not have (hew'd it. 

Leo. Do not draw the curtain. 

Paul. No longer (hall you gaze on*t, left your fancy 
May think anon, it move. 

Leo. 



382 The WinterV Tale. 

£^. Lee be, let be ; 
7 Would I were dead, but that, methinks, alreadj-^ 
What was he, that did make it? fee, my Lord, 
Would you not deem, it breath'd ; and chat chofe veins 
Did verily bear blood f 

Pol. Mafterly done I 
The very life feems warm upon her lip. 

Leo. ^ The fixure of her eye has motion in% 
As we were nnxrk'd with art. 

Paul, ril draw the curtain. 
My Lord's almoft fo far tranfpoited, that 
He'll think anon, it lives. 

Leo. O fweet PaulinOy 
Make me to think fo twenty years togtther : 
No fettled fenfes of the world can match 
The pleafure of that madnefs. Let't alone. 

Paul. I'm forry. Sir, I have thus far ftirr'd you ; but 
' I could af&ifl you further. 

Leo. Do, Paulina i 
For this afflidion has a tafte as fweet 
As any cordial comfort. Still, methinks. 
There is an air comes from her. What fine cbt2zd 
Could ever yet cut breath ? let no man mock me^ 
For I will kiis her. 

7 H^ou/J I nviTi dead, But thai, mitbi9ks, «Av4U^— ] Tlie 6b* 
tence compleated is, 

" tut that, methiixhf ahreadj I conver/e nuUb the dead. 
But there his paffion made Kim break oft 

8 The F ixu RB of her eye bos metion in*/,] This is fed nonfetiie. 
We fhould ready 

ne ¥19 svKJL of ber eye 
i. e. the focket, the place where the eye is. 

9 / €ouidziR\6i you further.'] If it had not been for fbeanrwer, 
one fliottld have concluded the Poet had wrote, affeayeu ; how- 
ever he ufes affliS in the fenfe of affeS, This l^ q^ly fMerved |o 
ihew» that when we find words to which we moSi pot an aimfaal 
fignification to make fenfe, that we ought to conclude SbahJ^eaif 
tMc that Kberty, and that the text is not corrupted. A ditng the 
O;0ri/ Editor ihould have confidered. 

PmI. 



T&f.WiNTBRV Tale; 383 

PauL Good my lord, forbear r 
The ruddkiefs upon her lip is wet \ 
You'll iDarr it, if you kifs it ; (lain your own 
With oily painting; (hall I draw the oirtatn ? 

Leo. No, not tbefe twenty ycars^ 

Per. So long could I 
Stand by, a looker on. 

PauL Either forbear^ 
Quit prefently the chapel, or refolve you 
For more aoiazenienc ; if you can behold itt 
1*11 make the fiatue more, indeed \ deftend. 
And take you by the hand ; but then yoa'U think. 
Which I proteft againft, I am aSifted 
By wicked ppwera. 

Leo. What you can make her do, 
I am content £0 look on \ what to fpeak» 
1 am content to hear : for 'tis as eafie 
To make her fpeak, as move. 

Paul. It is required. 
You do awake your faith ; then, all ftand ftill: 
And thoie, that think it is unlawful bufinefs 
1 am about, let them depart. 

Leo. Proceed ^ 
No foot fhall ftir. 

Paul. Mufick ; awake her : ftrike ; [MufcL 

*Tis time, defcend ; be ftone no nrx)re ; approach. 
Strike all that look upon with marvel. Come, 
I'll fill your grave up: (lir ; nay, come away: 
Bequeath to death your numbnefs \ for from him 
Dear life redeems you ; you perceive, (he ftirs ; 

[Hermione comes down. 
Start not ; her anions fhall be holy, as. 
You hear, my fpell is lawful ) do not fhun her^ 
Untill you fee her die again, for then 
You kill her double. Nay, prefent your hand ; 
When (he was young, you woo*d her ; now in ag^ 
Is fhe become the fuitor. 

Leo. 



384 ^ Winter'^ Tale. 

Leo. Oh, fbe's warm \ [Euibracu^ ber. 

If this be magicky let it be an art 
Lawful as eating. 

PoL She enibraces him. 

Cam. She hangs about his neck ; 
If (he pertain to life, let her fpeak too. 

Fol. Ay, and make it manifeft where flie has liv'd, 
Or how ftoKn from the dead ? 

PauL That fhe is living. 
Were it but told you, Ihould be hooted at 
Like an old tale ; but it appears, {he lives, 
Tho' yet (he fpeak not. Mark a little while. 
Pleafe you to interpofe, fair Madam, kned. 
And pray your mother's ble(fing ; turn, good JLndy : 
Our Per&ta is found. 

[Prefenting Perdita, who kneels to Herm. 

Her. You Gods, look down , 
And from your facred viais pour your graces 
Upon my daughter's head -, tell me, mine own. 
Where haft thou been prefcrv*d ? where liv'd ? how 

found 
Thy father's court ; for thou (halt hear, that I, 
Knowing by Paulina that the Oracle 
Gave hope thou waft in being, have prelcrvM 
Myfelf, to fee the iiTue, 

Paul. There's time enough for That ; > 
Left they defire, upon this pu(h, to troi^ 
Your joys with like relation. Go togertier. 
You precious winners all, your exultation 
Partake to every one ; *' I, an old turtle, 
*^ W ill wing me to fome withered bough, and there 
*^ My mate, that's never to be found again> 
" Lament 'till I am loft. 

Ijfo. O peace, Paulina : 
Thou fhouldft a husband take by my con(enc. 
As I by thine, a wife. This is a match^ 
And made between's by vows. Thou haft found mine, 

Bat 



The WinterV Tale. 385 

But howa is to be queftjon'd i for I faw her. 

As I thought, dead ; and have, in vain, faid manjr 

A prayer upon her grave. 1*11 not feck far 

(For him, I partly know his mind) to find thee 

An honourable husband. Come, Camillo^ 

And take her by the hand ; whole worth and honefty 

Is richly noted ; and here juftified 

By us, a pair of Kings. Let's from this place. 

What ? look upon my brother : Both your pardons. 

That e*er I put between your holy looks 

My ill fufpicion: this, your fon-in-Iaw, 

And fon unto the King whom heav'ns direfling, 

Is troth-plight to year daughter. Good Paulina, 
Lead us from hence, where we may leifurely 
Each one demand, and anfwcr to his part 
Feribnn'd in this wide gap of time, tlnce 6rfl; 
We were diflever^d. Hanily lead away. 

[Exeunt omnes. 



Vol. HI. Cc THE 




■.rv":V*»-/v.<# -:.>.;.^V'*»' 



THE 



LI F E and DEATH 



OF 



KING JOHN. 



(^mSl^S&ieaBKSKSISIHSSKi 



CC 2 




DRAMATIS PERSONjE. 

KING John. 

Priftce Henry, Son to tbe King. - i 

Arthur) Duke of Bretagne, and Nephew to tbe Kif^. 

Pembroke, 

Eflex, 

Salisbury, y Englifh Zorir. 

Hubert, 

Bigpt, 

Faulconbridge, Bajtard-Son to Richaid tbe Firft. y. 

Robert Faulconbridge, fuppos*d Brother to tbe BafieA. 

James Gurney, Servant to tbe Lady Faulconbridge. 

Peter cf Pomfret, a Prophet. 

4 

Philip, King rf France, 

Lewis, the Dauphin. 

Arcb-Duke of Auftria. 

Cardinal Pandulpho, tbe Pope's Legate. 

Melun, a French Lord. 

Chatilion, Amhajfador from France to King John. 

Elinor, ^een-Motber of England. 

Conftance, Mother to Arthur. 

Blanch, Daughter to Alphonfo King of C$Qikf fti 

Neice to King John. 
Lady Faulconbridge, Mother to tbe Baftsrii^' kd 

Robert Faulconbridge. j^ V4 -' 



Ctizens of Angiers, Heralds^ Executioner Sj Mejfef^ers 
Soldiers^ and other Attendants. 

the SCENE, fmetifMs t» England, andfometimes ^ 

in France. 

THE 



'The LIFE and DEATH of 

KING JOHN. 

ACT I. SCENE I. 

The Court of England. 

Enter Kh^ John, ^em Elinor, Pembroke, Eflcx, 
and Salisbury, with Chatilion. 

IQ}^ John. 
^~OW, &.Yt Cbaiiliesj what would Fi-aaet 
with lA ? 
Chat. Thus, after greeting, fpeaks the 
King t^ France, 
In my behaviour, to the Majcfty, 
The borrow'd Majefty of E^land here. 

Eii. A ftrange beginning i borrow'd Majcfty 1 
K. Jebn. Silence, good mother ; hear the embaflie. , 

■ Thi irtuiUfimt Riign ^ JDW Ji^ii wsu writtCB in two pant, 
bf W. Shaktjft»r and W.tta^tj. aod priored i&ti. But dw 
prefeot Pla)' u inuiely diffemt, and i&finucl/ fuperior to it. 

iSr. /*<//. 

Cc 3 OxU. 



390 King J o H K. 

Chat. PUlip of Prance^ in right and true bdudf 
Of thy deceafed brodier Geffref% ion, 
jfrtbur Plantagenet^ lays lawful claim 
To this fair ifland, and the territories : 
To Ireland^ PoiSliers^ Anjott^ T'ouraine^ Maine : 
Defiring thee to lay afide the fword. 
Which fways ufurpingly thefe leveral titles ; 
And put the fame into young Artbut^s hand. 
Thy nephew, and right*royal Sovereign. 

K. John. What follows, if we difallow of this? 

Cbat^ The proud controul of fierce and bloody war, 
T* inforce thofe rights fo forcibly with^held. 

K. John. Here have we war for war, and blood 
for blood, 
Contro ul m ent for controulment ; fo anfwer France. 

Chat. Then take my King's defiance from my moudi. 
The fartheft limit of my embaffie, 

K. John. Bear mine to him, and fo depart in peace. 
Be thou as lightning in the eyes of France^ 
For ere thou canft report, I will be there. 
The thunder of my cannon (hall be heard. 
So, hence ! be thou the trumpet of our wrath. 
And fullen preiagie of your own decay. 
An honourable condud let . him have, 
Pembroke^ look to't ; farewel, Cbaiilim. 

{Exeunt Chat* and Pem. 

Eli. What now, my fbn, have I not ever laid. 
How that ambitious Conftance would not ceafe. 
Till (he had kindled France and all the world. 
Upon the right and party of her fon ? 
This might have been prevented, and made whole 
With very eafy arguments of love i 
Which now the manage of two kingdoms muft 
With fearful, bloody, ifliie arbitrate. 

K.John. Our ftrong poflcffion, and our right for us — 

EIL Your firoDg pofieflion much more than yov 
right. 

Or 



King J o H H* 391 

Or eUe it muft go wrong wkh youandmci 
So much my conlcience whifpers in your car» 
Which none but heav*n, aind you, and I ihail hear* 

Efac. My Li^» here is cm ftrang^ controvtrlie, 
Come.from the country to be JMdg'd by you^ 
That e'er I heard : (hall I produce the men ? 

K. John. Let them ap{>roach. 
Our abbies and our priories ihall pay 
This expedition's charge What men are you i 

SCENE II. 

Enfer Robert Faulconbridgr> md Philip, bis Srotbir^ 

the Bafiard. 

Phil. Your faithful fubjcA, I, a gentleman 
Bom in Nortbamptonjinrey and eldeft ion, 
As I fuppofe, to Robert Faulconbridgey 
A foldicr, by the honour-giving hand 
Of Caur-de-lion knighted in the field« 

K. John. What art thou ? 

Robert. The fon and heir to that fame Faukonlridge^ 

K. John. Is that the elder, and art thou the Iieir? 
You came not of one mother then, it fcems ? 

PbiU Moft certain of one mothier, mighty King, 
That is well known \ and, as I think, one father : 
But for the certain knowledge of that truth, 
I put you o'er to heav'n, and to my mother ; 
Ox that I doubt, as all mens' children may. 

Eli. Out on thee, rude man ! thou dolt (hame thy 
mother. 
And wound her honour with this diffidence. 

Pbil. I, Madam ? no, I have no reafon for it \ 
That is my brother's plea, and none of mine j 
The which if he can prove, he pops me out 
At leafl; from fair five hundred pound a year : 
Heav'n guard my mother's honour, and my land! 

C c 4 K. John. - 



392 iOfwg John. 

K. John. A good blunt fellow s why, being ybonger 
born. 
Doth he lay claim to thine inheritance? 

Plnl. I know not why^ except to get the land \ 
But, once, he (lander'd me with baftardy : 
But whether I be true begot or no, 
That ftill I lay upon my mother's head 5 
But that I am as well begor, my Liege, 
(Fair fall the bones, that took the pains for roe !) 
Compare our faces, and be judge yourfelf. 
If old Sir Rohrt did beget us both. 
And were our father, and this fon like him ; 

old Sir Robert, father, on my knee 

1 give heav'n thanks, I was not like to tbee* 

K. John. Why, what a mad-cap bath hcav'a kdt 
us here ? 

Eli. He hath a trick of Cctur-de-lMs face. 
The accent of his tongue affcdeth him : 
Do you not read fome tokens of my foa 
In the large compofition of this man ? 

K.Jobn. Mine eye hath well examined his parts^ 
And finds them perfcft Richard: Sirrah, fpeak. 
What doth move you to claim your brother's land ? -^ 

Phil. Becauie he hath a half-face> like my father, ' 
With that half-face would he have all niy land ? 
A half-fac'd groar, five hundred pound a year! '-^ 

Rob. My gracious I Jege, when that my father liv*d. 
Your brother did imploy my father much j ■ ■■ 

PbiL Weil, Sir, by this you cannot get my« land. 
Your tale muft be, how he imploy'd my mother. 

Rob. And once difpatch*d him in ah embaifie 
To Germany ; there with the Emperor 
To treat of high affairs touching that time : 
Th' advantage of his abfcncc took the King, 
And in the mean rime fojourn*d at my father's ; 
Where, how he did prevail, I fhame to fpeak : 
But truih is truth ^ large lengths of feas and Aiores 

Between 



^ J o H N. 393 

Between my father and my mother lay, 
(As. I have heard my father fpeak himielf) 
When this lame luftiy gentleman was got. 
Upon his death-bed he by will bequeath'd 
His lands to me i and took it on his death. 
That this, my mother's fon, was none of his ; 
And if he were, he came into the world 
Full fourteen weeks before the courfe of time : 
Then, good my Liege, let me have what is mine. 
My father's land, as was my father's will. 

K. John. Sirrah, your brother is legitimate ; 
Your father's wife did after wedlock bear him r 
And if fhe did play falfe, the fault was hers ; 
Which fault lyes on the hazard of all husbands. 
That marry wives. Tell me, how if my brother. 
Who, as you fay, took pains to get this ion. 
Had of your father claim'd this fon for his ? 
In iboth, good friend, your father might have kept 
This calf, bred from his cow, from all the world. 
In fboth, he might ; then, if he were my brother's. 
My brother might not claim him ; nor your father. 
Being none of his, refufe him ; this concludes. 
My mother's Ibn did get your father's heir. 
Your father's heir muft have your father's land. 

Rob. Shall then my father's Will be of no force 
To difpoflefs that child, which is not his ? 

Phil. Of no more force to difpoflefs me. Sir, 
Than was his will to get me, as I think. 

EiL Whether hadft thou rather be a Faulconbridge^ 
And, like thy brother, to enjoy thy land : 
Or the reputed Son of Caur-deMan^ 
* Lord of the prefence, and no land befide ? 

2 Lord of rmr pnfinct^ and m land htjid§ f\ Lord of thy pre^ 
fonci can fagnify only, Mafior rf tbyftlfX and it is a ftraoge ex- 
preffion to fignify even that. However that he might be, with- 
OttC parting with his land. We ihoold read. 

Lord of m^ tnfence, ■ 
f. i. Prince of the Blood. 

PliU 



394 ^ John, 

Pbil. Madam, and if ooy brother had my iliape» 
And I had his. Sir Robert his, like him } 
And if my legs were two fuch riding rods. 
My arms fuch eel-skins ftufc i ' mv faoe fo thin, 
^ That in mine ear I durft not ftick a role. 
Left men (hould fay, ^' look, where three £u'thiqg^ 

goes! 
*^ And to his fhape were heir to all this land ;** 
'Would, I might never ftir from off this place, 
I'd give it ev*ry foot to have this face : 
I would no£ be Sir Nobbe in any cafe. 

EU^ I like thee well ; wilt thou forfake thy fortune 
Bequeath thy land to him, and follow me ? 
I am a fbldier, and now bound to France. 

PML Brother, take you my land^ Til take my 
chance; 
Your face hath got five hundred pound a year, 
Ya fell your face for five pence, and 'tis dear. 
Madam, Til follow you unto the death. 

EiL Nay, I would have you go before me thither* 



my fad fi thin^ 



Tkai m mmi ior I dmrft mi ftitk a io(e. 

Lift m9H JlmM fi^^ iook^ when thiverfartlitDgs goes}] 
We mnft oUervc, co explaia this allufion, Uiat Qveen Elitutittk 
was the firfi, and indeed the only Prince who coinM in EmgUmd 
three-halfpence, and three- farthing pieces. She at one and die 
fame time coin*d (hillings, fixpenccs, graat|ib diree-pencct, tmy 
pences, ttoehalf-penoe, pence, dtree-rartfaiags, and ludf-peace: 
And thefe pieces all had her head, and were altirtuUify wok 
the Rofi behind, and without the Reft. The fhilling, groac, two« 
pence, penny, and hdf-penny had it not : The other iatentie- 
diate coins, *vi%^ the fix-penoe, three-pence, three-half-pence, and 
three- farthings had the R^/e. Mr. n^Mi. 

4 Tfjat in mim ear / Aurjt n§t ftitk a rofe.} The ftieking R^ 
about them was then all Uie cour^&fluoll, at appears ftoa uus 
pailag^ of the Comfiffitn <latboiiqu9 dm S. df Sa»ty, 1. 2. C* i. |t 
luy ay appris a metcre des Rose s far tout Us ceimst i. e. i»#wy 
flact about him, fays tiie Speaker, of one to whom he had tvqilbc 
all the court-faihions. 



ISag John. 395 

PbU. Oar country mMiiers give our betters waf^ 

£. John. What is thy name ? 

PbU. PbUipt roy Lkge, fo is my name begun $ 
Pbitip^ good old Sir Jicheri*s wife's eldeft fon. 

K.Jobn. From henceforth bear bis name, whofe 
form thou bear'ft : 
Kneel thou down PbiUp^ but rife up more great ; 
Arife Sir Richard^ and Plmiagenet. 

Phil. Brother by th' mother's fide, give me your 
hand; 
My father gave me honour, yours gave land. 
Now bleflcd be the hour, by night or day. 
When I was got. Sir Robert was away I 

E&. The very fpffit of Plantagenet ! 
I am thy grandiam ; Ricbard^ csdl me fb. 

Phil. Madam, by chance, but not by truth ; what 
though ? 
Something about, a little from the right. 

In at the window, or elfe o*er the hatch : 
Who dares not ftir by day, mufl walk by night. 

And have his have, however men do catch ; 
Near or far off, well won is ftill well fhot \ 
And I am I, howe'er I was begot. 

K. John. Go, Faulconbridgeyuovr haft thou thy defire ; 
A landlefs Knight makes thee a landed 'Squire : 
Come, Madam ; and come, Richard ; we mud fpeed 
For France f for France ; for it is more than need. 

PbiL Brother, adieu i good fortune come to thee. 
For thou was gpc i'ch way of honefty • 

[^Exeuni all but Philip, 

SCENE III. 

A foot of honour better than I was. 

But many a many foot of land the worfc ! 

Well, now can 1 noake any Joan a lady. 

« Good 



396 ^^ John. 



4« 
4€ 



44 
44 



•* Good-den, Sir i2jVi&tfrrf,——Godamercy, fellow ; 
♦* And if his name be George^ I'll call him Peter ; 
•• For new-made honour doth forget mens* names : 
** *Tis too refpedlive and unfociabJc 
•* For your convcrfing. Now your traveller. 
He and his tooth-pick at my worlhip's mefs ; 
And when my knightly ftomach is fuffic'd, 
** Why then 1 fuck my teeth, and catechife 
My * piked man of countries ; — My dear Sir, 
(Thus leaning on mine elbow, I begin) 

I fliall befccch you,— that is queftion now 5 

** And then comes anfwer like an ABC-book : 
" O Sir, fays anfwer, at your belt command, 
*^ At your employment, at your fenricc. Sir :• 
•* No, Sir, lays queftion, I, fweet Sir, at yours,- 
^ ^ And fo e'er anfwer knows what queftion would^ 
*^ Saving in dialogue of compliment; 
^^ And talking of the yilps and Apenninesy 
" The Pyrenean and the river Po ; 
*^ It draws towards fupper in conclufion. To. 

But 

5 PihJmsui,'} /'./. formally bearded. Mr./^. 

6 Andfi iir anfwer inows what fuefiion 'wow/d, I 
Saving i« diaUgut ofcomfUmemt] In this fine ^Kech, A«/* 

cMtridgi would (hew the advanuges and prerogatives of mm ^f 
moorjbip. He obrerves, particularly, that ht has the Traveller a^ 
command; (people at that time, when a new world was difcovcr- 
ing, in the higheft eiUmation) At the firil intimation of his defire, 
to hear ftrange ilories, the Traveller complies, and will fcaroe give 
him leave to make his queftion, but e'er anfrutr hmmme mtbrnt m^- 
fion would — What then, why, according to tho prefent readng» 
it grows cowards Tapper- time ; And is ttoi this ^uMrJhifful Jotktff 
To fpend all the time between dinner and fupper before etcho' of 
them knows what the other would be at. Read s £ r v 1 ng isftentf 
oifwing, and all this nonfenfe is avoided ; and the account Hands 
thus, '* £*er anfwer knows what quellion would be at, Qyr-.ciav«l« 
** ler/ervit in bis dia/egme e/ comp/ime/itf which is hisfiaadiiig 
*< diih at all tables ; then he comes to talk of the Ah§ amt-j^ 
** nines. Sec. and, by the time this difcourfe ooQclnaes, k^diMl' 

** towaeds. 



King John. 397 

^* Bat this is worfhipful fociety. 
And fits the mounting fpirit like mylelf : 
For he is but a baftard to the time. 
That doth not fcnack of obiervatk>n ; 
[7 And fo am I, whether I fmackor no:] 
And not alone in habit and device. 
Exterior form, outward accoutrement y 
But from the inward motion to deliver 
Sweet, fweet, fweet poifon for the age% tooth | 
Which tho* I will not pradiic to deceive. 
Yet, to avoid deceit, I mean to learn ; 
For it fhall drew the footfteps of my rifing. 
But who comes in fuch hafte, in riding robes ? 
What woman-poft is this ? hath £he no husband^ 
That wili take pains to blow a horn before her? 
O me! it is my mother ; now, good lady. 
What brings you here to court fo hallily ? 

■ 

SCENE IV. 

Enter Lady Faulconbridge, and James Gurney. 

Lady. Where is that flavc, thy brother, where is he. 
That holds in chafe mine honour up and down ? 

Pbil. My brother Robert, old Sir Robertas fon, 
Ctdbrand the giant, that fame mighty man. 
Is it Sir Robertas fon, that you feek fo ? 

" towvxls fapper.** All this ii fimiible and kumoroos t and the 
phiafe of/irvng m is a rtry pleafant one to denooe that this wat 
his woiihip's fic$md cwrft. What follows (hews the romantic torn 
<Mf the TOjagers ofthaetime; how greedily theh lelatums were 
fwallowed, which he calls fwut fnfm fir tht agts Hotb\ and 
how acceptable it made men at court— fVr // fimll fir$^ tht '^^^ 

fi§ifttfs 9/ mf rijbtg. And yet the Oxfird Editor lays, by this 
/wut ffifin is miant fiaturj. 

7 Andfo mm /, nvbithgr I/macl 9r ivs ] A noofenfical line of the 
Playcn. 

Lady. 



398 X3ng John. 

Lady. Sir Roherfs fon ? ay, thoo uarev'rend boy» 
Sir Roberts fon : why fcom'ft thou at Sit Robert ? 
He is Sir Robertas fon \ and fo art thou. 

PbU. James Gumeyy wilt thoo giTC us kavc a while ? 

Gur. Good leave, good PhiRp. 

Pbil. • Philip ! ■ fpare mc, James ; 
There's toys abroad i anon I'll tell thee more« 

[Exit James. 
Madam, I was not old Sir Robertas fon. 
Sir Robert might have eat his part in me 
Upon Good-Friday^ and ne'er broke his faft : 
Sir Robert could do well ; marry, confefs ! 
Could be get me ? Sir Robert could not do it ; 
We knew his handy-work ; therefore, good naotfaer. 
To whom am I beholden for thefe liinbs i 
Sir Robert never holpe to make this 1^. 

Lady. Haft thou confpir'd with thy brother too. 
That, for thineown gain, ihould'ft defend mine honour? 
What means this fcorn, thou moft untoward knave ? 
Phil. 9 Knight, Knight, good mother— —£4^/r}29 
like. 
What ! I am dub^d ; I have it on my fhocdder : 
But, mother, I am not Sir Robertas fon ; 
I have difolaim'd Sir Robert^ and my land ; 
Legitimation, name, and all is gone : 
• Then, good my mother, let me know my father i 
Some proper man, I hope; who was it, mother? 

8 Pbilipf fparrow, Jamis.'] I think the Poet wrote, 

Fhilipl fpare me^ Janus. 

i. e. don't af&ont me with an appellation that comes from a Fa- 
mily which I difdaim. 

9 Knight, Knight, gogJ av0#i&/r— BafiUfco /fi/ ] The words al- 
lude to an exprefiion in an old fooliHi play, then the oommoo bat 
of ridicule. But the beauty of the paHage coofifta in his allad* ' 
ing» at the fame time, to his Jiigh original. Hi$ £ither, Rktmd 
thtfirfi^ was fumamed Caur-dt-liw. And the Cw Lf§m$t aiasri 
ftaroi the firft magnitudey in the iign Lep, is called Bafili/a. 

Lady. 



Xhg J o H M- 399 

Ladf. Haft thou dcDy'd thy felf a Faukanbri^e? 

Pbil. As faithftilly, as I deny the devil. 

Lady. King Richard deur-de-lim was thy father ; 
By )m%% and vehemenc fuit, I was fediic*d 
To VD&t room for him in my husband's bed. 
H»v*n lay not my tranigreflion to my charge! 
Thou art the iflue of my dear o&nce. 
Which was fo ftrongly urg*d paft my defence* 

PbU. Now, by this light, were I to get again. 
Madam, I would not wilH ^ better Yather. 
Some fins do bear their privilege on eanh. 
And fo doth yours \ your fault was not your folly ; 
Needs muft you lay your heart at his dilpofe^ 
Subjedbcd tribute to commanding love ; 
Againft whofe fiiry, and unmatched force. 
The awleis lion could not wage the fight ; 
Nor keep his princely heart from Richard's hands« 
He, that perforce robs lions of their hearts. 
May eafily win a woman's. Ay, my mother. 
With all my heart, I thank thee for my father. 
Who lives and dares but (ay, thou didft not well 
When I was got, PlI fend his Ibul to hell. 
Come, lady, I will (hew thee to my kin. 

And they (hall (ay, when Richard me begot. 
If thou hadft (aid him nay^ it had been fin ; 

Who fays, it was, he lyes ^ 1 (ay, 'twas not. 

[Exeuttf^ 



ACT 



400 Kiftj^ Jo H,N. 

ACT 11. SCENE 1. 

Before the Walls of Anglers in Fnuice. 

Enter Philip King cf France, Levris the Dnp4iin» the 
Arcbduh cf Auftria, Qmftande, and Aithiir. 

Lswis. 

BEFORE Anglers well met, brave Aufiria. 
Arthur ! that great fore-runner of thy blood 
Richard^ that robb'd the lion of his heart. 
And fought the holy wars in Palejline^ 
By this brave Duke came early to his grave : 
And for amends to his pofterity. 
At our importance hither is he come. 
To fpread his colours, boy, in thy behalf; 
And to rd>uke the ufurpation ^ 

Of thy unnatural uncle, Englijh John, 
Embrace him, love him, give him welcome hither. 

Artb. God (hall forgive you Caurdelion^s death 
The rather, that you give his ofF-fpring life ; 
Shadowing their right under your wings of wan 
1 give you welcome with a powVlefs hand. 
But with a heart full of unftained love : 
Welcome before the gates of Anglers^ Duke 

Lewis. A noble boy ! who would not do thee right ? 

Auft. Upon thy cheek lay I this zealous kift. 
As fcal to this indenture of my love ; 
That to my iiome I will no more return. 
Till Attgiers and the right thou haft in France^ 
Together with that pale, that whitc-fac'd fhore, 
Whofe foot fpurns back the ocean's roaring tides. 
And coops from other lands her iflanders ; 
Ev*n till that England^ hcdg'd in with the main» 
That water-walled bulwark, ftill fccurc 

And 



Gng John. 401 

And confident from foreign purpofts, 
Ev'a till 6tiX OQtmoft corner of the weft, 
Salute thee for her King. Till then, lair boy. 
Will I not think of home, but follow arms. 

Confl. O, take his mother*s thanks, a widow's thanks. 
Till your ftcong hand Ihall help to give him ftrengch. 
To make a more requital to your love. 

jhft. The peace of heav'o is theirs, who lift their 
fwords 
In luch a juft and charitable war. 

K. Pbilip. Well then,- to work ; our engines Ihall 
be bent 
Againft the brows of this refifting town ; 
Call for our chiefeft men of dilcipline. 
To cull the plots of bed advantages, 
We^il lay before this town our royal bones. 
Wade to the market*place in Frenclhmenf blood. 
But we will make it fubjeft to this boy. 

Conft. Say for an anfwer to vour Eoibaflie, 
Left unadvised you ftain your iwords with blood. 
My lord Cbatilim may from Efigland bring 
That right in peace, which here we ur« in war i 
And then we mall repent each drop of blood. 
That hot rafh hafte ^ indiredlly (hed. 

Enter Chatilion. 

K. Pbil^. A wonder, lady! lo, upon thy wilh 
CXir meflenger Chatilion is arrived \ 
What England fays, fay briefly, gentle lord. 
We coldly paule for thee. Chatilion^ ffcsk. 

Chat. Then turn your forces from this paultry fieg^ 
And ftir them up againft a mightier task. 
England^ impatient of your juft demands. 
Hath put himfelf in arms ; the adverfe winds, 
Whofe leifure I have ftaid, have giv'n him time 
To land his legions all as loon as I. 
His marches are expedient to this town. 

Vol. III. Dd Va$ 



402 King J d H «• 

His forces (Irong, his (bldiers confident. 

With him alortg is come the mother-Queen % 

An Jle^ ftirring him to blood and ftrife. 

With her, her neice» the lady Blanch of Spami 

\V^ith them a baftard of the King deceased* 

And all th' unfettled humours of the land ^ 

Ka(h, inconfid'rate, fiery voluntaries^ 

With ladies' faces, and fierce dragons' fbleenSs 

Have (old their fortunes at their native nome^s 

Bearing their birthrights pfdudly on theif back^ 

To make a hazard of new fortunes here. 

In brief, a braver choice of dauntleifs fpirits. 

Than now th^ Ef^lijb bottoms have waft o^fer^ 

Did never float upon the fwelling tide. 

To do oflfence and fcathe in chriftendom. 

The interruption of their churlilh drums \JDrum% Uet. 

Cuts oS more circumfta|ic€ ; tbey are at hafid. 

To parly, or to fight, therefore prepate. 

K. Philip. How much unlookM for is this ex- 
pedition \ 

Auft. By how much unexpe&ed, by h much 
We muft awake endeavour for defence ; 
For courage mounteth with occafion : 
Let them be welcome then, we zft prepaid. 

S C E InT E 11. 

Enter IGng of ^n^2^^ F^ulconbridge, Elinor, Blancbt 

Pembroke, and others. 

K. John. Peace be to France^ if I^ance in peact 
permit 
6ur juH and lineal entrance to our own : 
If not, bleed France^ and peace afoend to heav'a. 
Whilft we, God's wrathful agent, do correct. 
Their proud contempt that beatls his paace to heav\i; 
K. Philip. Peace be to Eng^andy if that war RtuTIi 
From France to En^land^ there to live in peace! 

FtigUuii 



Kkg }OHV. 403 

England we love ; and for that England^s &ke 
With burthen of our armour here we fweat 1 
This toil of ours fliould be a work of thine. 
But thou from loving England art fa far. 
That thou haft under-wrought its lawful King } 
Cut off the (equence of pofterity; 
Put-£iced infant ftate ; and done a rape 
Upon the maiden virtue of the crown. 
Look here upon thy brother Geffref% fecc. 
Theft eyes, theft brows, were moulded out of his 5 
This little abftraft doth contain that large. 
Which dy'd in Geffrr^ ; and the hand oT time 
Shall draw this brief into as larg^ a volume. 
That Geffrey was thy elder brother born. 
And this his (on ; England was Gefrefs right. 
And this is Geffref^ ^ in the name of God^ 
How comes it then, that thou art call'd a King, 
When living blood doth in theft temples beat. 
Which own the crown that thou o'er-maftcrcft ? 

K. John. From whom haft thou this great commi A 
fion, France^ 
To draw my anfwer to thy articles ? 

K. Philip. From that fupernal judge, that ftirs good 
thoughts 
In any breaft of ftrong authority. 
To look into the bolts and ftains of right. 
That judge hath made me goardian to this boy ; 
Under whofe warrant I impeach thy Wrong, 
And by whoft help I mean to chaftife it. 

K. John. Alack, thou doft ufurp authority. 

K. Philip. Excufe it^ 'tis to b^ ufurping down. 

Eli. Who is*t, that thou doft call ufurper, France t 

Canji. Let me make anfwer : thy ufurping fon.— — 

Eli. Out, inftlent ! thy baftard ihall be King, 
That thou may^ft be a Queen, and check the world ! 

Conft. My bed was ever to thy fon as true. 
As thine was to thy husband ; ana this boy, 

Dd 2 Liker 



4C4. i5»g John. 

Likcr in feature to his father Geffrey^ 

Than thou and Jobn^ in manners being as like 

As rain to water, or devil to his danri. 

My boy a baftard! by my foul, I think. 

His father never was, fo true- begot; 

It cannot be, an if thou wert his mother. 

EU. There's a good mother, boy, that blots thy father. 
Conji. There's a good grandam, boy, that would 

blot thee. 
Aufi. Peace'—— 
Faulc. Hear the crier. 
Aufi. What the devil art thou .? 
'^ Faulc, One that will play the devil. Sir, with you, 

An a'may catch your hide and you alone. 
You arc the hare, of whom the proverb goes, 
Whofe valour plucks dead Lions by the beard ; 
Til fmoak yMr skin-coat, an I catch jrou right) 
Sirrah, look to't ; i'faith, I will, i* faith. 

Blanch, O, well did he become that Lion*s robe. 
That did difrobe the Lion of that robe. 

Faulc, It lyes as fightly on the back of him. 
As great Alcide^ * fhews upon an afs ; 
But, afs, I'U take that burthen from your back. 
Or lay on that, ihall make your flioulders crack. 

Aufi. What cracker is this fame, that deafs our cars 
With this abundance of fuperBuous breath ? 
King Pbilipj determine what we •ftiall do ftrait. 
K. Philip. Women and fools, break off your con- 
ference. 
King John^ this is the very fum of all ; 
England^ and Irelandy Anjou^ Touraine^ Maine^ 
1 right of Arthur I do claim of thee : 
Wilt thou refign them, and lay down thy arms ? 

K. John. My life as foon. — I do de6e thee, ^tfiic(i 
Arthur of Britain^ yield thee to my hand ; 
And out of my dear love Til give thee more^ 

I Sbnjoi\ Spelc right by Mr. The^Ald. 

Than 



Khjg John. 405 

• ■ 

Than e'er the coward-hand of France can win* 
Submit thee, boy. 

Eli. Come to thy grandam, child. 

Confi. Do, child, go to it grandam, child. 
Give grandam kingdom, and it grandam will 
Give it a plum, a cherry, and a fig ; 
There's a good grandam. 

j4rtb. Good my mother, peace •, 
I would, that I were low laid in my grave % 
I am not worth this coil, that's made for me. 

Eli. His mother fhames him (6j poor boy, he weeps. 

Cbnft, Now ihame upon you, whe're fhe does or no i 

is grandam's wrongs and not his mother's Oiamet, 



Draws thofe heav'n-moving pearls from his poor eyes, 
Which heav'n fhall take in nature of a fee : 
Ay, with thefe cryftal beads heav'n flialj be brib'd 
To do him juftice, and revenge on you. 

Eli. Thou monftrous flandcrer of heav*n and earth ? 

Ccftji. Thou monftrous injurer of heav'n and earth ! 
Call me not flandcrer -, thou, and thine, ufurp 
The domination, royalties and rights 
Of this opprefled boy •, this is thy eldcft fon's fon. . 
Infortunate in nothing but in* thee : 
Thy fins are vifited in this poor child ; 
The canon of the law is laid on him % 
Being bat the fecond generation 
Removed from thy fin-conceiving womb. 

K. Jobn. Bedlam, have done. 

Con/l. I have but this to fay. 
That he is not only plagued for her fin. 
But God hach made her fin and her the plague 
On this removed ifiTue, plagu'd for her. 
And with her plague her fin ; his injury. 
Her injury, the beadle to her fin. 
All punifh'd in the perfon of this child. 
And all for her, a plague upon her! 

££. Thou uoadvisM fcold, I can produce 

Dd J A 



4o6 KifJg John. 

A will, that bars the title of thy fon. 

Co^tjt, Ay, who doubts that ? a will ! — a wicked will j 
A woman's will, a cankred grandam's will. 

K.Pbil. Peace, Lady 5 paufc,orbemorc4;empcnitc; 
It ill befcems this prefence to cry Aim 
To thefe ill-tuned repetitions. 
Some trumpet fummon hither to the walls 
Thefe men of Jngiers \ let us hear them fpeak, 
Whofe title they admit, jirfbur^s or Jobn*s. 

[Trumpet fmnii^ 

SCENE IIL 

Enter a Citizen upon the TFalls. 

Cit. Who is it, that hath warnM us to the walls f 

K. Philip. *Tis France^ for England. 

K.John. England far itklf i 
You men of Angiers and my loving fubje6ts ■ ■ ■ 

K. Pbilif. You loving men of Ang^rs^ Artlm^i 
fubjeds. 
Our trumpet call'd you to this gentle parle— — — 

K. John. For our advantage ; therefore hear us firft : 
Thefe flags of France^ that arc advanced here 
Before the eye and profpedt of your town. 
Have hither march'd to your endamagement. 
The cannons have their bowels full of wrath \ 
;, And ready mounted are they to Ipit forth 
. . Their iron indignation 'gainft your walls : 
All preparations for a bloody fiege 
And mercilefs proceeding, by thefe French^ 
Confront your city's eyes, your winking gates ; 
And, but for our approach, thofe fleeping fiooeSf 
That as a wafte do girdle you about. 
By the compulfion of their ordinance 
By this time from their fixed beds of lime 
Had been difliabited, and wide havock made 
For bloody power to mfh upoii your ^pwt. 

But 



King J o H N* 407 

But on the fight of us your lawful King, 
(Who painfully with much expedient march 
Have brought a counter-check before your gates^ 
To fave unicratch'd your city's threatned cheeks) 
Behold, the French^ amaz'd, vouchfafe a parle \ 
And now, inftead of bullets wrap*d in fire , 
To make a fhaking fever in your walls. 
They fhoot but calm words folded up in fmoak* 
To make a faithlefs error in your ears \ 
Which truft accordingly, kind ckizens \ 
And let in us, your King, whofe laboured fpirits, 
Fop&^eary'd in this afbion of fwift fpeed, 
Oave harbourage within your city-waUs. 

K. PbUip, When I have faid, make anfwcr to us 
both. 
L.O !' in this riffht hand, whole protection 
Is mpfl: divioely vow*d upon the right 
Of him it holds, ftands young Plantagemt s 
Son to the elder brother of this man. 
And King o'er him, and all that he ertjoys. 
For this down-trodden equity, we tread 
In warlike march chbfe greens before your town : 
Bemg fio further enemy to you^ 
Than the conftraint of hofpitable zeal^ 
In the relief of this oppre^ child, 
Reiigioufly provokes. Be pleafed then 
To pay tfcttt duty, which you truly owe 
To him that owns it ; namely, this young prince. 
And then our arntis, like to a muzded ^ear^ . 
Save in afped, hath all offence feal'd up: 
Our cannons' malice vamly iball i>e fpent 
Againft th' invukiecaUedouds of heav*n i 
And with a bleiifed, and unvext retire, 
<Widi ufthack'd fwords, and hdmets ail unbruis'd^ 
We will bear home that lufty blood again, 
'Which iieM we caccMs to fpout ^^il yow towAi 
And leave your children, wives, and-you ia peace* 

Dd 4 But 



4o8 King J o h k* 

But if you fondly pafs our profierM offin*, 
' Tis not the rounder of your old*fi^^d walls 
Can hide you from our mefieng^rs of war % 
The* all thefe EngHJb^ and their difcipline. 
Were harbour'd in their rude circumference. 
Then tell us, (hall your city call us lord* 
In that behalf which we have chilleog'd it? 
Or fhall we give the figoal to our race, 
And ftalk in blood to our poflelfion f 

CU. In brief, we are the King of Et^lan^s fiibjcftsi 
For himt and in his right, we hold this town. 

K. John. Acknowledge then the King» and lee me io. 

Ci/. That can we not} but he that proves the 
.King, 
To him will we prove loyal ; *till that time. 
Have we ramm*d up our gates againft the world. 

K. John. Doth not the crown of Engkmd pion 
the King? 
And if not that, I bring you witnefles. 
Twice fifteen thoufand hearts of E^lMtPt hittA «*^ 

Faulc. (Baftaixts, and elfe.) - ( 

K. J^. To verify our title wkh their lives* 

K. PbiUp. As many, and as well-born Uooda ai 

Faulc. (Some baftards too.) 
K. PbUip. Stand in his fiice to contradiA his dsaixxu 
Cit. Till you compound^ whole right is wordiicA^ 
We for the worthieft hold the right from both« 
K. John. Then Qod forgive die Iiq of all tfao(s 
fouls. 
That to their everlafting rdOdence, 
Before the dew of evening fall, fhall fleet. 
In dreadful tryal of our kingdom's King ! 
K. Pbilipn Jm^i^M^^^^-^-^^-^Momt chevalierSi is 

arms ! 
Ru^c. Saint C^^ that fwingfd Uw <ln^A, wi 
^'^rfince 

m 



King John. 409 

Siu on his horfeback at mioe hofteis' door. 

Teach us fbme fence. Sirrah, were I at home 

At your den, firrah, with your Lionels, 

I*d fet an oz-bcad to your Lion's hide. 

And make a monfter of you.—— [To Auftria. 

jftift. Peace, no more* 

Fafilc, O, tremble i for you hear the Lion roar. 

K. John. Up higher to the plain, where we'll iet 
forth 
In beft appointment all our regiments. 

Faulc. Speed then to take th* advantage of the field. 

K. Philip. It fhall be fo \ and at the other hill 
ConuDand the re(t to ftand. God, and our right! 

SCENE IV. 

jt hi^ Charge founded : iheUj after excurfttms^ anter tha 
Herald of France with trumfets to the gates. 

> /*. fbr. You men ofAngiersj open wide your gate% 
And let young Arthur Duke of Bretagne in $ 
Who by the hand oi France this day hath made 
Much work for tears in many an EngUfi mother, 
Whofe fons lye fcatter*d on Ihe bleeding ground : 
And many a widow's husband groveling lies^ 
Coldly embracing the difcolour'd earth ; 
While vi^ory with little lofs dodi play 
Upon die dancing banners of the French i 
Who are tf hand triumphantly difolay'd. 
To enter conquerors ; and to proclaim 
^thur of Bretagne^ &itgland^$ King, and yours* 

Enter Englilh Herald with Trumpets. 

- S. Her. Rejoioe, you men of^giersi ring your 

bellsi 
^ingjohuy your King wdEf^land^s^ doth approacht 
Q>miniuidc;r of this hot malicious day, 

Thcif 



i 



41 o Kifig John. 

Their armours, that march'd hence (b filver-brighe. 
Hither return all gilt in Frencbmens* blood. 
There (truck no plume in any Englijb Creft, 
That is removed by a ftaff of France. 
Our Colours do return in thofe fame hands ; 
That did difplay them, when we Brft marcb'd forth; 
Andf like a jolly troop of huntfmen, come 
Our lufty Englijby all with purpled hands ; 
Dy'd in thedyin^ flaughter of their foes. 
Open your gates, and give the vidtors way. 

Cit, Hcr^dfi, from off our tow'rs we mi^t bdiold» 
From firft to lad, the Onfet and Retire 
Of both your armies, whofe equality 
Bv our beft eyes cannot be cenfured ; 
Blood hath bought blood, and bk>ws have anfwer'd 

blows ; 
Strengfth maCchM with ftrength, mi pow« oonfiioatfd 

power. 
Both are alike, and both alike we like ; 
One muft prove greatcft. While they weigh lb even. 
We hold our town for neither j yet for bow. 

S C E-N E V. 

Enter the two Kings with their Powers^ at feverd 

Doors. 

K« John. France^ h^ft thou yet more blood to caft 
away ? 
Say, (hall the current of our Right run on ? 
Whofe paflagc, vext with thy impediment. 
Shall leave his native channel, and o'er-fwell 
With courfe difturb^d ey'n diy.ooofintDg ihpres; 
Uoieis thou let his filver water Jceep 
A peaceful progrcfs to the ocean. 
Jv. Philip. England^ thou haft: Apt favM one dcpp 
of blood 
4a this hot tryal, more than we oi France i 

Radier 



King J o H N« 411 

Rather loft more. And by this hand I fwear, 
That fways the earth this dinnate overlooks. 
Before we will lay by our juft-bome arms, 
We'll put thee down, 'gainft whom thefe arois we bear % 
Or add a royal number to the dead \ 
Gracing the icroul, that tells of this war's lofi. 
With &ughter coupled to the name of Kings. 

Faulc. Ha! Majefty, — how high thy glory towers. 
When the rich blood of Kings is fet on fire ! 
Oh, now doth Death line his dead chaps with fteel ; 
The fwords of Ibldiers are his teeth, his phangs ; 
And now he feafts, mouthing the flefh of men 
In undetermined differences of Kings. 
Why ftand thefe royal Fronts amazed thus f 
Cry havock. Kings ; back to the ftained field» 
You equal Potents, fiery-kindled fpirits ! 
Then let Confiifion of one part confirm 
The other's peace ; till then, blows, blood, and death. 

K. John. Whole party do the townfmen yet admit ? 

K. PbiSp. Speak, Citizens, for England^ who's your 
King? 

G/. The King of England^ when we know the 
King ? 

K. PbiSp. Know him in us, that here hold up his 
Right. 

K. John. In us, that are our own great deputy^ 
And bear pofleffion of our perfbn here ; 
Ix>rd of our prelence, Anglers^ and of you. 

Gi. ^ A greater powV, than ye, denies all this ( 
And till it be undoubted, we do lock 
Our former fcruple in our ftrong^-barr'd gates. 
Kings are ouf fears, until our fears reibly*d 



2 A ffriattr ^mvV, tham WB^ tkniis aU ihu i 

Kings o F 9ur ftarst'—^l We fhould read iboB yu WliaC 
power was this ? their y/ar/. It is plain therefore we fhooM read 
Kings art Bmr fears ^ 

/• #• our fears a» the Kingp which at pnfe&t rule ot. 

Be 



1 

4T2 Kwg JOHN. 

Be by ibme certain King purg'd and deposM. 

Faulc. By bcav*n, the Scroyles of Angiers flout you, 
Kings, 
And Hand fecurely on their battlements. 
As in a Theatre, whence they gape and point 
At your induftrious Scenes and A^ of death. 
You royal prefences, be rul'd by me ; 
Do like the Mutines of JtrufaUm^ 
Be friends a while, and both conjointly bend I 

Your fharpeft deeds of malice on this town. I 

By eaft and weft let France and England mount 
Their battering cannon charged to die mouths ; 
Till their ibul-fearing clamours have braul'd donn 
The flinty ribs of this contemptuous City, 
rd play inceflantly upon thefe jades \ 
Even till unfenced defolation 
Leave them as naked as the vulgar air. 
That done, diflever your united ftrengtbs. 
And part your mingled Colours once again ; 
Turn face to face, and bloody point to point. 
Then in a moment fortune fhall cull fonh 
Out of one fide her happy minion ; 
To whom in favour me fliall give the day. 
And kifs him with a glorious Vidory. 
How like you this wild counfel, mighty States ? 
Smacks it not fomething of the Policy ? 

K. Jchn. Now by the sky, that hangs above our 
heads, 
I like it well. France^ fliall we knit our Powers, 
And lay this Angiers even with the ground. 
Then, after, fight who Ihall be King of it? 

Faulc. And if thou haft the mettle of a King^ 
Being wrongM as we are by this peevifti town, 
Turn thou the mouth of thy artillery. 
As we will ours, againft thefe fawcy walls*; 
And when that we have dafh'd them to the ground, 
Why, then defie each other \ ^nd, pell*mell. 

Make 



King John. 413 

Make work upon ourfelves for heav'n or helL 

K. Philip. Let hbe fo ; lay, where will youaflault ? 

K. John. We from the weft will fend deftrudion 
Into this City's bofom. 

Aiji. I from the north. 

K. Philip. Our thunder from the fouth 
Shall rain their drift of bullets on this town. 

Faulc. O prudent difcipline ! from North to South ; 
Auftria and France fhoot in each other's mouth. 
I'll ftir them to it ; come, away, away ! 

CH. Hear us, great Kings ; vouchfafe a while to 
ftay. 
And I (hall ihew you peace, and fair-fac'd league ; 
Win you this city without ftroak or wound ; 
Refcue thofe breathing lives to die in beds. 
That here come facrihces for the field ; 
Perlever not, but hear me, mighty Kings. 

K. John. Speak on, with favour ; we are bent to 
hear. 

Gt. That daughter there of Spain^ the lady Blanch^ 
Is near to England ; look upon the years 
Of Lewis the Dauphin^ and that lovely maid. 
If lufty Jove fhould go in queft of beauty. 
Where fhould he find it fairer than in Blanch f 
If zealous love fhould go in fearch of virtue. 
Where fhould he find it purer than in Blanch f 
If love, ambitious, fought a match of Birth, 
Whofe veins bound richer blood than lady Blanch ? 
Such as fhe is, in beauty, virtue, birth. 
Is the young Dauphin every way compleat : 
If not compleat^ (a) oh lay, he is not fhe; 
And fhe again wants nothing, (to name Want,) 
If Want it be not, that fhe is not he. 
He is the half part of a blefled man, 
Left to be finifhed by fuch a She : 
And fhe a fair divided Excellence, 

}h. Oxford Editor— Vttlg. e/^.] 

Whofc 



414 ^*!g John. 

Whofe fulnefs of perfeftion lies in him. 

Oh ! cwo fuch filver currents, when tbey join» 

Do glorifie the banks that bound them in : 

And two fuch fhores, to two fuch flreams made one. 

Two fuch controlling bounds Ihall you be^ 

To thefe two Princes, if you marry them. 

This union fhall do more than battery can. 

To our. faft-cloled g^tes : for at this match. 

With fwifter Spleen than Powder can enforce. 

The mouth of paflage ihall we fling wide ope, 

Apd give you entrance ; but without this match^ ' 

The fea enraged is not half fo deaf. 

Lions fo confident, mountains and rocks 

So free from motion ; no, not death himfelf 

In mortal fury half fo peremptory, 

As we to keep this City. 

Faulc. Here's a ftay. 
That {hakes the rotten carcafs of old Death 
Out of his rags. Here's a large mouth, indeed. 
That fpits forth death, and mountains, rocks and feas % 
Talks as familiarly of roaring Lions, 
As maids of thirteen do of puppy-dogs. 
What Cannoneer begot this luuy blood ? 
He fpeaks plain cannon- fire, and fmoak and bouncej 
He gives the baftinado with his tongue: 
Our ears are cudgeled ^ not a word of his. 
But buffets better than a fift of France i 
Zounds ! I was never (b bethumpt with words. 
Since I firfl: calPd my brother's father dad.. 

ElL Son, lifl to this conjunftion, make this maicl^ 
Give with .our Neice a dowry large enou^ s 
For by this knot thou fhalt fo furely tie 
Thy now unfur'd ailurance to the Crown, 
That yon green boy ihall have no Sun to ripe 
The bloom, that promifeth a mighty fruit. 
I fee a Yielding in the looks of France $ 
Mark, how they whifper } urge them, while their ibiifa 

Are 



King J o H «• 415 

Are capable of this ambition ; 
Left zeal now melted by the windy breath 
Of foft petitions, pity and remorfe. 
Cool and congeal again to what it was. 

Cil. Why anfwer not the double Majefties 
This friendly Treaty of our threatened town ? 

K. Philip. Speak, Ettgland^ bxO:^ that hath been 
forward firft 
To fpeak unto this City: what iiiy you? 

K. Jobn. If that the Dauphin there, iliy Princely fbn, 
Can in this book of beauty read, I Icvei 
Her dowry fhall weigh equal with a Queen. 
For AfijWf and fair Touraine, Maine^ PoiSliersj 
And all that we upon this (ide th6 lea. 
Except this City now by us befieg'd. 
Find liable to our Crown and Dignity, 
Shall fiild her bridal bed ; and make her rich 
In titl^, honours, and promotions ; 
As ihein beauty, education, blood. 
Holds hand with any Princefs of the world. 

K. Pbil^. What fay 'it thou, boy ? look in the lady*) 
face. 

Lewis. I do, my lord, and in her eye I Hnd 
A wonder, or a wondrous miracle \ 
The fhadow of my&lf form'd in her eye ; 
Which, being but the ihadow of your ion. 
Becomes a Sun, and makes your fon a ihadowj 
I do proteil, I never lov'd myfelf. 
Till now, mfixed, i beheld myfelf. 
Drawn in the flat^ring table of her eye. 

{Whifpering wiih Blanclv 

Faulc. Drawn in the ilatt'ring table of her eye I 

Hang'd in the frowning wrinkle of her browl 
And quartered in her heartf he doth efpie 

Himfelf love's traitor : this is pity now. 

That hanged, and drawn, and quartered, there ihould be. 

In fuch a Love, fo vile a lout as he^ 

Blanche 



4i6 Xhg JoHK. 

Blamb. My UQcIcfs will in this re^peflr h mineu 
If he fee aught in you, tint makes faim like^ ' 
That any thing he fees, which moves his Ukmg^ 
I can with eafe tranflace tf to mf w2i^r ^ ' - ^ 
Or if you will, to fpeak more properlfV 
I will enforce it eafilyio my^kyvc ' 

Further I will not- fiocter you, my tentf > . - ^. • 
That all I fee in you is worthy lovei ' * 
Than this ; that bochingttlol fee In yoQi '- ' * ^'« 
(Though churlifh thoughts themfdws AdoM be joti 
judge) • - . - -.!.>- 

That I <san fyid'^flxouia HBeritf ^ny lOEft; • 
K. John. What&ytfadeyoungOncsfWtetlfrfyM|. 
mjfNfjicc? *r^- - *. . %// 

Blanch, l^hat fliers iibund in HoMrfl^flffltObdfr^-f 
What you in wiOomiblLiroilchfafetTiiy. ' ^'• 

¥..Jobn. Speak iiieiT/PlfiiiceB^iMl^«tay«tfi(M' 
this lady? /' - • • ^-^ *^ - -"^ ^« - 

I/wii. Nay, aak me» if I can itfMlf iMltovttr ; 
For I do love her moft unfeigned^/* ^ *-w «• ?*•'-.' 

K. John. Thenrdo i giyeWjif^^; 4<aPW< i y» ^Mif, 
Paiffier;^ tmd Afipu^ thde.five Provinces, 
With her to thee \ and this addition more. 
Full thiny thoufand Nfarks of Bftgl0 coin. 
Philip of France^ if thou be plea^d withal. 
Command thy Son and Daughter tojmiJMkd%i 

K. Philip. It likes us well ; youngfeFk|iiie8,' 

your hands. iiL-«. * •. -• • 

Auft. And your lips to6 ; for, I anrw^ cibr^d, y 
Tjiat I did foy when I war^firft aflur^iH - "i «^' • 

K. P£;7/;>. Now^Citizensof ^;((ftffi,opeyoca:grtci^ 
Let in that amity whiohjotthavcuiade:" • " ' 
For at Saint Mar/t Chapid prcfcntly ' \ 

The Rights of Marriage ihall be iblemnia^d. ' '■'"- 
Is not the lady C^anetin this troop? -*' ^ \ 

I know, fhc is not ; foMhis Match made-up "^''*^ 
Her prefcnce would have-interrupted much. -^ 

Whot 



King ] o Htk 417 

Where is (be and her fon» tell me, who knows? 

Lturis. She's fad and paffionate at your Highnefs* 
Tent. ^ 

K. Pbilip. And, by my faith, this league, that we 
have made. 
Will give her iadnefi very little Cure. 
Biocher of Et^land^ how may we content 
This widow lady ? in her Right we came ; 
Wfakh we, God knows, have, turned another way 
To our own vantage. 

K.Jobn. We will heal up all. 
For we'Jl create young Arthur Duke of Briimn^ 
And Earl of Richmond ^ and this rich fair town 
We make him lord of. Call the lady Conjidnte i 
Some fpeedy Meflenger bid her repair 
To our Sokmnity : I truft, we ihalt. 
If HOC fill up the meafurc of her will. 
Yet in ibme meafure iatisfie her 1b^ 
That we (hall ftop her exclamation. 
Go we, as well as hafte will fufier us. 
To this unlQok'd-for, unprepared. Pomp. 

[^Exeuni all hut Fauloonbridge* 

SCENE VI. 

Fauk. Mad world, mad Kings, mad compofition! 
y&bn^ to ftop Artbur*% Title in the whole. 
Hath wiliii^ly departed with a part : 
And France^ whofe armour Confi:ience buckled on. 
Whom Zeal and Charity brought to the field. 
As God's own foldier, rounded in the ear 
With that fame purpofe«changer, that Qy devil. 
That broker, that ft^l breaks the pate of faith, 
That daily Ixeak-vow, he that wins of all. 
Of Kings, of beggars, old men, young men, maids^ * 
Who having no external thing to Jofe 
But the word Maid, cheats the poor maid of that ; 

Vol. UL Ec That 



C€ 
<C 
CC 



That rmpoth-fac'd gentleman, tickling Comchodicy^— 
Cofifimodity, die biafe of tht Wdrid, 

The world, which of itfelf js poifed well. 
Made to tfin tven, upon evi^n ground ; 
Till this advantage, this vile-drawing biifs. 
This fway of motion, this Commodity, 
<^ Makes it take head from all indifTerency, 
** From all direifioh, purpofc, courfe, intent. 
And this fame biafs, this Commodity, 
This bawd, this broker, this all-charrging word, ^ 
Clapt on the outward eye of dckle f^dfict^ 
Hath drawh him ftoHi his oWn d^ermfh*d aid. 
From a refolvM and honourable war. 
To a moft bafe atid vile-cbnciuded jbcacei-*-— 
And why rail I oh thk Commodity f 
But for becaufe hie bath not Mrobed me yet :' 
Not that 1 have the power to chitch imy h&nd. 
When his fair ai^els would falute My ^paim ; 
But that my hand, as xinattehfiptM ye|i^ ~ 
Like a poor beggar, laiiedi orithe l-ieh. 
Well, while I am a beggar, I Will raili 
And lay, the^e is tio flnbut to be rich : 
And beinjg rich, my virtue then fhall be. 
To fay, there is no vice, but begguy. 
Since Kings break faith upon oommodityy 
Gain, be my lord 1 'fi»^ i will wor0iip thcte f [^Emi^. 




ACT 



ACT m B C E N JS j; 

^Tbe French Kirk's Pavifion. 

m 

Enter Confiwiee, Arthur, Md SalMinirf^ 

Con SfT. A. Nc 9. 

GO N £ to be imrry?dl go^e to fmgfl a peace!. 
Falfe l;)l9Qd to &)fe Uood jom*d! Gooe to be 
friends! 
Shall L^ms have Blamb^ and ^At^i^tbofi^ provinces? 
Ic is not fo, thoii baft inifH^kc, ouf-hqar^ i 
Be weU-advJs*da teU o'er thy tafe again^ 
It cannot be; tboudoft bat iayi* 'tis fo. ^ 
I truft, I may not truft thee \ for thy word 
Is but tbe vain bffflch.cf a^ooimnon man; 
Believe me^ <I ydo not beljoHFc thee». man^ 
I have a King's oatbjD the concrary* 
Thou fliak te puAifli'dcibr ;thns frighting fpf^ 
For I ana fiok, and q^paia^i^< fears; 
Oppreft wkh >wroq0E^ and ibenefmie fiiiliOif fe^ta: 
A widow^ busbandk6» fulfoofi: 10 fcacs s 
A woinan^ naowaliy bom to fears, 
Andy tho' ibom. aow confeft thoudicUl but jeft» - 
With my veiK fp]sics:I^wni»ttake a truces 
But they will quake iwd (ramble all thfB day. 
What doll tbou.<Qran^ ,ibakii)g of thyheatl? 
Why doft xhoa look ^ il^ly .<^ jtny fon? 
What means cbati)a4d#BPR Chan^bra^ft of Khine? 
Why holds-tbinogajfe^jtl^ l^nM^j^I^ rheum> 
Like a proud river ^p^ags^'^rhi^ bounds P 
Be thefe iad £ghs ^afirows of \hy ^€|rds? 
Then fpeak again^ not all thy former tale. 
But this one word» wHethertby tale b^.tnie. 

Sal. As true^ as, I beUeve, you tbi^ik .(hepi falfe*. 
That give you qw&^m, iproye 9iy faying /(rue. 

£e a ConJI^ 



420 king jioHN. 



Cmji. Ohj if thou teach. me to believe ihb^fotiowy 
Teach thou this forraw how to m^ke/ne die ; 
And kt belief and life cntoiantcr fo,, / ^ ^ 
As doth the fury of two dcfp'rate men. 
Which in the very meeting, fall and die, 
Lewis fred Blanch t Q boy, then wnere art thou? 
France friend with England! what Ixcdnies of me? 
J^eilow, be gone, I cannot brook thy fight: 
This news hath made thee a moft ugly npani 

Sat. What other harm have I» good lady^ done. 
But fpoke the harm diat is by others .done ? 

.Cofi0\ :VVhich harm within itfelf {o heinous is. 
As it makes harmful all that fpeak of it. 

jirib I do bcfcech yoji, mother,, be content. 

Coftft. ** IF thou, tMt bidft me be concent, wen 

grim, 

** Ugly, and flandVous to thy mothcr*$ womb. 
Full of unpieafing blots, and fightlefs ftains. 
Lame, fooliih, crobk^d, fwart, prodigious, 
Patch'd with foul moles, and eye-ofiending marks ; 
** I woukl not care, Fthen would be^rotitent: 
** For then 'I Ihould not love thee: no, nor thou 
^* Become thy great birth, nor deferre a crbwn. 
*^ But thou art fair,' and a< thy birth, dear boy ! 
^* Nature and fortune jdln'd to itiabethee great. 
^ Of nature'^ gifts thoo {Mky'ft whfh Wh'es boaft, 
" And with the half-bld#n-itife/' But fortune, oh! 
She is corrupted, changM, and, woivirom thee. 
Adulterates hourly with thine uncle 7oiw ; 
And with her goklAi hand hath pluckt on France 
To tread down fair refpeft of fovenlgricy, 
And made his majefty the bawd to theirs. 
France is a bafwd to fortune, and to y^ ^ 
That ftrumpet fortune, that ufuiping •jf'^ / 
Tell me,- thou fe)k>w, is not Franci fMrfwom? 
Envenom him with words; or get thee gone. 
And leave theie woes alone, which I alone . 

Am 



CC 



r 



King JoH H. 421 

Am bound to under- bear. ^ 
Sal. Pardon me. Madam, 
. I may not go without yoa to tlic Kings. 

C0ijl* Thou may'ft, thou (halt, I wilt not go with 
thcc. 
I will inftruft my forrows to be proud 5 
For Grief is proud^ and malces his 6wner (a) ftout. 
To me, and to the State of my great Grref, 
Let Kings aflenible : for my Grief's fo great. 
That no Supporter but thc'huge firm eaith 
Can hold it up: Here I dnd' Sorrow fit: ' 
Here js my Throne, bid Kings come b6^ to it. 

^ ' — \Sit$ d(Wn'6n thi Floor: 






.., :;s c E.:.^", E mi:.. 

Enter X/xr^Jphn,JCff^ Philip, Lewis, Blahcht £Iinor» 

Faulconbridge, and Auftrial^ 

K PbiUp, 'Tis true, fair daughter^ 4ad this biefled 
day . 
Ever in Fnmce ihaU be k«pc ftftivaK: '- 
To ibknmtze ihis.dtyr the glorious fun- 
Stays in hts coorie, and plays ihe akhymifir^ 
Turning with fplendor of hi« precioiiit eye » 
The meagre oloddy earth to glittering . gold. 
The yearly icourfe, that briogs this day.'about, 
Sbdll Aertti^fi)e.'it,*biKa^^y«day; 

Qtfi. A uridosd day» and oo(aii boly«*day>-— 

What hathi dvl» dav deler^'d ? what . hath k 4oiie, 
That it in golden letter, lh<M)d be iet 
Among the high tides . in *cbe < Jcaleodar ?. - ^ 
Nay, rathei^tltn» this day out of (he weekt 
This day of ^iliamei oppre(pont p<^Qury: 
Or, if it'Oiuft Ilaiid^ ftill^ Ipc wi^es. with child 

"Ee 5 • Pray, 



w « f 



42* f^ng J a »'it. 

I Pray, that their burthcn3,may nOt'fall tKis day. 
Left that their hopes pfodigibudy be cfott : 
But on this day^ let feaqien f<iar rib wrec)^ ^ 
No bargains break, that are ndt this day^ idade ^ 
This day, all things begun come to ill^etid. 
Yea, faich, itlblf* to hollow fajjiood cHan^^ ! 

K.Pbilipl By heaven, lady, you fHall hivt nocaule 
To curfe the fair proceedings of this day : 
Have I not pawn^ to you my Majeftyr 

Conft. Yoii have beguil'd me with a counterfeit 
Refembli^g Majefty, whiqh^ touched j^nd try'd, 
Proves valuelefs.: you are'forfworn, fbrfworii, ' 
Ydu came )n arnns to fpill my enemies blood. 
But now in arois, you ftrpngthen }t with yours. 
The grapling vigour, and rough frown of war. 
Is cold in anvjijy and painted peace» ^ 
And our bppreffidii hath^ ' maae up th rs l^gtie ; 
Arm, arni, yft heav'rii?, ag^inft thefe pcrjurM Kings: 
H wido^ cms^ be bUsbetid t6 me* heav'n ! 
Let not the hours of this ungodly day 
Wear out the day ia ^oe r but ere £ijQ-(et, . 
Set armed diftord.'cwi)|[t thcf^ perjurM Kings. 
Hear m^, 0h^ hokx fine K , 

jiufi. L$<^y Canftance^ |>eace, , ^ 

Conft, ,WAr, war, no peace ; peace is to nW a war. 
O Lymogssi^ O Auftria ! thou doft Ihaoie 
That bloody fpoil; thQU flavc^ chou wreccfat thop 



ThoQ little valiant, great in villanyj 
Thou ever fthDrig i^rf the ^|^6f)gc^ ftdk 5 
Thou fortune's champion^, thai ddt. never, fight 
But when her htUBOurous Jadyfhip is by . 
To teach tlVee iafety ! chcis art perjorM too^ 
And footh'ft up greatnefs. W hat a fdbl art thowj^ 
A rampii^ fool» to brag, to (^amp, and iwcar^ 
Upon my party ; thou cold-blooded flavc, 
(iaft thou not fooke like thunder gn rpy fide ? 

Ren 



Been fworn my foklier, bidding me depend 
Upon thy ftars, thy fortune, and thy ftfengt^? 
And doft tnou now fall over to my foes? 
Thou wear a lion's hid^ ! doff k igr ihame. 
And hang a caIveVs}cin on thofe recreant limbs. 

jiufl. O, that a man \^quld fpeak thol^ words to me ! 

Faulc. And hang a c^lveVskin on thofe recreant; 
limb^. 

^uft. Thou (Jar'ft nQt fav fo, villain, fpr thy life. 

Faulc, And hang a calve Vskin on thofe ' recreanf 
limbs. 

* yiuji. « Mqthinks, that Ricbard^s pride ^nd Ri^ 

cbard'shll ' ' ■ \^' , ; 

* Should be a precedent to fright you. Sir. ; 

* Faulc. What words are thcfe? now do niy finew? 

(hake! " * 
My father's foe clad in my father's lj)0if! 
How doth jfleHo whifper in my ears. ^ 
Delay not, Richard^ kill the villain ftrait; " 
Difrobe him of the matcMeft monument. 
Thy father*s triumph^o^er the favages.-^ 
l>low by hi? foul 1 fwear, my father's fouf, 
Twice will I not review the rnqming's Vife, 
Till I have torn that trophy from thy back j 
And fplit thy heart, for wearing it to long. 
K. John: We like not this, thou doft forget thyfelf. 

1 Methinks^ that RichardV fridi &c.] What was tlie groaixd 
of this qoarrd of tlie Baftard Xx^Aufiria is no whtrt fpccify*d in 
the prefent play : nor is there in tM^plftce* or the fi^eoe where it is 
firft hinted at (namely the Aspond of A& 2.) the ^ift xpention of 
any reafon for k. But the'^ory is, that Auftru^t who k^iPd King 
Richard Caurde^lion^ wore as die fpoil of ttiat Prince, a lion^s 
hide which had belonjgM to him. This dreomftanoe Henders the 
anger of the Bajlard very Q9turi4, «ad ot^ht pot to haye .})een 
omitted. In the firil sketdi of this play (which Shakej^ar is li^d 
to have had a liand in, jointly with fVilliam Rowley) we accord* 
ingly find this infilled upon, and I have ventured to place a few of 
thofe verfes here. Mr. Psft, 

Ec4 SCENE 



,424 ^^' f H;^f; 

S> C R: N B f: JU. 

£ii/^r Paodulph. - 

K. J^fcifc>: Hcl^ comei the holy Legato of the Pope. 

Pa^: Hail, you antiinted Deputies of hcav*n !- 
To theci King Jobn^ my hdy errand hi ^ 

I Pandulfh^ of fair AfiV^fff Cardinal,- 
And from Pope Innocent the Legate httr,- - 
Do in his aaine reiigioufly demand 
Why thou agaiiift the CInjrch, o^ hc)y Moibcr, 
So wilfully doft fpurn,-and force perforce 
Keep Stephen Langton^ chqfen Archbifivop • 
Qi Canterbury^ from tharfiolySce? ^ 

This in 3Dtff ♦forlald ho)y f'jrtiicr's niatte, ' • 

Pope Innocent t I * db demand of rilee* 

K. John, What earthly name to tnttrMgacories ^ ^ 
Canaciok rfae free breath oi ^ iacred K}r»gf 
Tbttu canft not, Cardimi], devife a nahje' "^ ^ 
Soiligfait, unworthy, and ridiiputottt,' ' 
To charge me to an anfwer, as the ^o^ ' " ' ^^ J 
Tell him this tale, and froiii the moHlhiOf Engimi - 
Add thus' much ipore, fhi^ no halian^^xvdSt^ ^ 

Shall tithe^or toll in oMr dominions: ^ 1 

But as Wip Imder heaven ai(e ftipreme head, - ' ^ 

So, undor^him, that g«eac Sdprema<iy,\ «^ ^ ^ - 
Where we do re^gn, we-wiH ^ione uplitdd } ' 

Withov^4h^^ alliftancrioi^ a ^nibrf al hat^*^- i 
So tell the Pope, aW^c^treWftiiet upwe^ * ^* t>:i 
J^tt hip lahdohii bfurp^ibthArity; - ' ' ii* :i* • ' * . ^ . 

IC. Philip. Brother qf England^ you b)a|^beme in 

Kr^Jfb9t. :{rhot yboi aiid ^ dff - Kmgr<pf ^ ChnfleDK 

Are led fo:gr6fly'i>yHchttiiincJdJing;Prft^ * 

Preadiag£.the cur fe, t hatf mony maj^ Jbuy out ^ 
And buy the muit d^wvjle^oldy dmf(, diilt^ ' 
^urchafe corrupted pardon of a man, . - 

Who 



Who in that fale fclb pardon irom himiUf : 
Tho' yoUfbnd alt'the reft, ib groQy led9' 
This jugting witch-craft with revenue cheriflii 
Yet 1 a)one» alone, do i^ oppofe 
Againft ihe Pope, .and coqnt bis frieixii 097 fbes, 

Fami. Then %]r the lawful power that I haVe^ 
Thou (halt (|and curft, and eacoonmanieafe ^ 
And blefied (balliie be, that dofh revok 
From his allegiance to an heretkk ; ^ - . 
And meritorious t^l that hund becallV]^ 
Canonized and vM>^ip{/d U a &iiAr» . 
That takes away by aof fecapct oourfe - * ' 
Thy hateful J i^» .r~ ' >,.. 

Confi. O, lawfiil Jet k be^ > o 

That I have roooa with :Jiom^ tOrCQrie a *«^iJe«r 
Gopd father CardtnaU cry thoUf <4ini9^ . 
To my bw^ cwfe I for .wicheiK mf wrong . 
There is no coo^ut hath power to $urfe hkn Hght, 

Pand. Tfi^$ kw, and. wacraae, lady, for my oodc; 

Conft. And iForoimcGdoi |irbenJawGUH)o.iM^r%ht, 
Lft ic be lawful that Jaw bar no wrong : 
Law cfitHiot gtve mjr child, hit kingdooi hete 3 
For he, that holds his kt/iffidonii hoMn the law 1 
Therefore, fince law itfirffis perfcdt wrongs < 
How can tl\e jaw forbid my , tongue to cwfe^ 

Paftd. Philip QfJrtfMcef on peril of a curfe. 
Let go th^ band. of thai arch-beretick \ 
. And raife the jpow'r of EvHce upon hit hfaad, 
Unlefs he do lubintt himfelf to Xme, 

Eli. Look*ft thou pdk^, FrMCff do liolt letgo Aj 
hand. - 

Cm/i. Look to that, devil I left that Framt^repent, 
And, by dMjoinmg hands, beU bfe a foul. 



itaMta 



jfuft. King Philips llften to the Cattlinal. 
Faulc. And hang a caive's skin on his recreant limbs. 
yfuft. Welly ruffian, I muft pocket up thefe wrongs, 
Bec^ufe ■ ■ ' ■ 

Faulc. 



436 l*»|P»lci 

Fauk. Yonc brQM;bf)s (kA m an;y %si. 

K. John. Pbi^j^ wl^t &u*(k uipii, cq the Cardina]? 

CMft^ WM flWyl4«l^ %> IW sw ttye Cardinal? 

£ravi. Bethink y4jf^ &(^ » f<^c ^K^ dlflKo-qiQe 
Is pqfQhafii pf a^ hqayy ^urie froip iZpWt 
Or th9 light Ipft o^ $^iaf4 fpr a friQn4> 
Forgo the «ifi^^ 

Blanch. That's.t^ cvcfe of A?)K9^. 

C(^. J>mj» ftan4 &(l } (he PevU tempts thee ^^ 
In likenefs of * a Q<(^ u^fritnoifc) bride. 

£/Mi:ir. The lady Qo^jkfci Cf^sifi wt froin^ bet faUh ) 
But from her neq4. . , ^ 

C911/?. Oh, if thou giant my need. 
Which only lives but by the de^th 9I! ^itb. 
That need .g^i^ need^ Jqier thi$ pfincij^. 
That &kh woi^d live agfiin t)y de^h of ne^d : 
O, then tread dqw^ i^y need, • and £fith mpi^(s up ^ 

Keep my need yp, w4 ^^^^h ^^ ^r944%.f^Q''^'^- 
K.y^A. The JCiog is (pflv*d, ^^r^*f^cr% z^ot to 

.'this. (J 'f . 1 

Cottft. O^ he recpQv'd fpom him, .^ afiWcr well 
yfv/?. Po lb, Kin^ Philip ^ h^ng np, more in doubt. 
F^U. Hang nothing but a c^lye'^Tskjin^ moll fwcct 

lout. 
K. PbUff, I am perpjext, am| know not yf hat to lay. 
Pand. Wi^at can'4 t{)ou fay, bi^ wi]l perplex thee 
more. 
If thou ftfiid ei^coo^nfuiicate and icprft ? 
K. Pbiiip.^ Gqod i^Y>enfl f^hff^ ,ipfik^ my pprfoo 

And tell me,, how yqu would bellow, yourfd/. 



• 8 -— ** « jvmc; marimmid hrkti.'] Mx. Thst^iiid Hty ft, £&«! «J 
trimMud €amifitMe»r m»yJffnAtii/tmn:tofyin»i ^iift tfif/tn/e rimirid^ 
it muft be corrupt; chi^fore he will c^ua itf ai^ rca(id» #■/ 
trimmed i in whicd he is followed by the Qxjord tAiWK v bdOt (lief 
are both too haliy. It fqoares very wdl -^th tlie fenie, and ^gfti* 
£6$ unfttadf. T(ic terra \a taken from HavigscioB* We fey u»o, 
in a iimilar way of fpeakingi nnt *will manned. 

This 



la^jVa^ 42f 



This royaf hand and imnc aw nn*rrf Tcnit; 

And the conjondion of oor inward iouls 

Marry'd in league, coupled slhd linked cogger 

With all religious ftrength of lacred vows: 

The lateft breathy that gave the found of words. 

Was deep-fwom faith, peace, amity, true lovv. 

Between our kingdoms and our royal Selves, 

And even before this truce, but new before. 

No longer than we well could waffi our handy 

To clap this royal baigain up of peace. 

Heaven knows, they were faefmeiffM and over^ftaiaVI 

With daughter's pencil ; where fc v eng e did pabit 

The fearful dtlPrence of incenfed Kings. 

And ihall thele hands, fo lately pu^g^ of Ubod, 

So newly joinM in love, (b ftrong in bodi, 

Unyoke this feizure, and this kind regreet? 

Play fall and loofe with faith? fb, jeft with hefiv^ft^ 

Make fuch unconilant children of ourfelvcjs. 

As now again to fnatch our palm from palni ? 

Un-fwear faith fwom, and on the marri^e-bed 

iX fmiKng peace to march a Moody hoft, 

And make a riot on the gentle brow 

Of true fmcerity ? O hoi j Sir, 

My reverend father, let it not be ib ; 

Out of your grace, devife, ordain, impofe 

Some gentle order, and we fhall be bleft 

To do your pieafure, and continue friends. 

Pond. AH form is fermkfs, order orderlefi. 
Save what is oppofite to England^ love. 
Therefore, to arms! be champion of our Church! 
Or let the Church our mother breathe her cuHfc, 
A mother's curfe on ker revolting ion* 
France^ thoti may*ft hdd a lerpent by the toogoe, 
A chafed ]yon by the mortal paw, 
A fading tyger iaitr by the tood). 
Than keep in waw that havi, wUcb thou daft 
hold. 

K. PbUif. 



428 King Jo HIT. 

K. Piv^, I max .^^^J9^n my band^ but not mj 
faith. 

P^«,^ mak'ft thou faith an enemy to &ith ; 
And, like ai:iv)I war^ Ict'ft oadi^to path, 
Tby tongue againft thy tongue. O, let thy vow 
Firft mad^tt^ feeav'p, Srft be to heav*n performed ; 
That is, ta he the champion of our Cburcb*. 
What fincc thop (wor'ft, is (worn againft thyfelf ; 
And may.npt jl;^ performed by thyfelf. 
For tbat wbich thou h^Q; (worn to dp amifs, 
■ Is yet ami&» whcp It & truly done: 
And being, not done^ w^erc doing tends to ill| 



|jjrcciu>n tncrcDj grows direct, ;. 
Ifliood falfliood cure$ j as fire cods' fire, 
I tbe fcorched veins of one qew-1>uuliM. 



Yet indirection thereby grows direft, 
Aod falJhood " '" 

Within tbe fc , ^ „^ 

It is reh'gioQ that doth piake vows k?^ .., .. \ 
* But4l»PU haft fworn againft religicyi; _ V *i/ . ''''^[, 
By wjx^f thou fwe^r'i^, ^gaind tbe tHuik thpif A^e^ 
And ihiiK'fl: an oath .the furcty for ^"tttilh/ 
Againft in oath the truth thou art unnOT-^J~ ' ' ' 
To fwar,' fwear only, not 16 be forf^^A 5 ' 

3' Is NOT 'iur{/r, ovi^^tt /Y'/i /fufy Jwe ;1 ThU 1$ A CbiidoMi 
^r traiHrs. Wc fliould read", ' '' ' ^ *'>n^ *' • ••.'»/; 

The OxfirJ Editor, according t^)^%:u{uj4 c«iAAiff» V^ ip|^i^ k 
further, andreads* n^.atf^t% . ../«,. , , » 

4 ' ^jv/ //&^« i&4/(? /worn o^inn reunion : kc/V ik'ihM Y<6ne fpb^ 
the Legate 13 made to m'e% iTi^'ikill in c^fb^y^i-'aWaWiM^ 
heap ofquibbte and nonfenfe of which- it itotiiSftliifnuiBtesri 
10 ndiculr:tfaa« «f ^he fcJ#>U,y Fo^ ?^iK>#w<» t%«ol«* 
dan. at th^wsAfAtm of chc^.4i»d «A* j^^C||tttSbw rakes }^m laVe 
tt another rate.' Iroeaii in ^hat b&utifui tafGige wfrefe be (beika 
of themifcMe^ falfo^njS'tfiii Kkigs M^ 4ir MtYdbjeat iMrts. 
This condofi is remarkam, and was iatended, J^ffpptk^ to ihev 
ua howmwrb kmet^foUpamk !tb€jU^ Mitiefa^ar^ ^>B|iii- 
vines. . . t 

£Ue 



i. 

'At 

'it' .1 



Elfc what a rtockery Ihbuld ft l)e to fwtttr'? ' * 
But thou doft fwcar, only to, be forfworn,' \ 
And moft fori^worn, to kccp^hat thou ddft iRteir. 
Therefore thy fatter vows, agrfinft thy fifft, ' - 
Is in thyfelf rchcllion to thyfclf. 
And better c6nqiicft never canft thou nnalcTS 
Than arm thy conftant ^nd thy nobler parti ' 
Againft thcfc giddy, loofe foggcffions: ^ ' 

Upon which better pan^ our prayVs con^e ih^ 
If thou v'ouchfafe them. Sut If not^ then kil6y> 
The peril of our curfes h'ght on thee ^' « 

So heavy^ as thou fhaJt not (hakt thetil olFi' *^^ ' 
But, in dcfpaif, die umkr their black wcigfit. "^ ' 

^i(/?. Rebellion, flat rebelljOft, 

Faulc. Wiirt not be f — ' ^ 

Will not a calvc's-skin (lop thit mouth of tbtrti?' 

i>to;i. Father, to arms. ' 

Blancbi ' Dpon thy wedding-day ? ^ 

Againft the blood that thou haftr married ? » ' ' ' ' 
What* ^all pur feaft be keot with (laughtrt*d tnfehf 
Shall braying trumpets^ and bud dturliili dhms; 
Qamours of ficll, be meafures to our pomp*?'' 
O husband, hear me; (ah! atatik, how new ^ 
is husband in my mouth?) tv*n for that nttine* 
Which till this time my tongue did ne*er pronoupce* 
Upon my knee I beg, go not to arms r- 
Againft nrine uncle* 

C^J^. O, upon nty knee,: 
Made h^d Wjjth kneeling, I db pray to tHee;\ 
1[*hoM MirtMOiis- JRwif &'»> altct, not the doom ^/"\ 
Faorethooghti 6y^ hear*!!. • 

i»/4ji»rin t<^6Wthftlf I fee thjrte^c % what mociw[»maf 
Be ftroiiger" ^Lith thee than tne .narnt of wifd? 

Conjt^ Thui' which upholdet'h him, thai t^e up- 
holds,^ .:;r':-jM .:•,-.. 

His honour: Oh, thi«tf h«ft«W, JLwiV, tUnc ho- 
nour ! — — 

Lewis. 



43® ^i J o H ». 

Lewis. I iHife your A&jefty doth ieem Ibcold^ 
W hen fuch pro&uod pefpeAs do pull you on ? 

4^4f0d. i will denounce a curfe upon his head. 

K. Pbikp. Tbou ihak not need. England^ Til fall 
from thee. 

Conji. Oi^r Feturn of banilh'd Majefiy ! 

Eli. O foul revolt of Frsnch inoonftancy ! 

K. John. Franc^y thou Qialt rue ^s hour within 
this hour. 

FmIc. Old time the dock-foier, that bald fextoQ time. 
Is ity as he will \ well then, Frmce Iball rue. 

Blanch. The iun'so'ercaft with blood : fw day, adieu! 
Which is the fideitbat I rouft gp witb^I ? 
I am with both, each army hath a haaid» 
And in their rage, I having hold of ,iM>th9 
They whirl afunder, and difmember me. 
Husband, I cannot pray i^nt ^w may'ft win : . 
Uncle, I needs muft pray that tjyxi lOiay'ft lofe : 
Father, I may not wifh the ibttuD^ tfaine^ . 
Grandam, I will not wilh thy wUbies chrme^ 
Whoever wins, on that fide fhall I lofe« 
AiTured lofs, before the rmaich be play^d^ 

Lexois. La(fy, with me, with me thy feituaelies. 

. . t^lnficb. There when my foroiAQ J)yes» fhere ny 

life dies. 

K. John. Coupn, go draw our puiffimce tc^ether. 

[Exit Faulcoobri(%e. 

Franccy ^ ^m burn'd up with inflamjng wraths 

A sage, whofe.heat bat)) (his condiUo/n 

l^hat nothing can allay, nothing but blood, 

^ Th8 blood, and deareft-valu*d blood of Frame. 

K. Philip. Thy rage ihall burn thet t)p> and thou 
Jhik tum^v ^ 

To''afiie$, ere our blood ihall ^ench that fire: 
Look to tfayfelf, thou irt in jeopardy, 

lers hie. ^. . ...• -;[£»«»«/. 

SCENE 



Khl^ Jo UK. 4;^ 

« - • 

E N E IV. 

Changes to a Field of Battle. 

Auftria^j Hdad. 

i^^w&.VTOW, by my IiTc, this day grows Won- 

1/N d'rous hot ; 
^•'Sbrtie Hefy deVil hovSft in the sky, 
And pours down tnifchicf. Auftria^s h6d Ifc thc»— 
Thus hath "King RicbdrdStpn perform^ hW rdw^ ' 
And offered AuJiruC^ blood for racrifice * - 
Unto his fkher's evd'^ivang Ibu!. * / 

EnUr JSmiyixBL^ Arthur, and ifiibett. 

K. ^vbn. There^ fhAeti^ keep this boy. 'ftHhatl, 
make up ; 
My mother is alSklled in out (fciit. 
And u'tn, I fear. 

Faulc. My lortl, I refcu*d htt : 
Her highnefs is in &fety, fear you hbt. 
But OTky my Liege; for very fitttepairts 
WiU faring this labour to an h^py «nd. '[^^'^^^ 

« • • 

S . C E N E *y, ' 

jHarmSi EtccurJionSj Retreat. Re-enter ISng J6iin» 
Elinor, Atthar» Faulconbridge, Hvbcn^^ndlMjh. 

JLJobn. $0 fliali it be^ your Grace Aali Aay be- 
hind . • ' * ' 
So ftrohgly guarded : Coufin, look fioc i«d, 

(jfffAftbtfT, 
Thy grandaqi lores thee, and tiiy mfek miil 

5 'Sems Jilry **^/7— ^] We 'mtiit fcad, &W il«y Atu*/,. if 
ve will have the csttfi eqnal to the ifia. 

As 



- .. # 



•s 



kT/om. Coufin away for Et^gitmdf^iat^iabaoTe^ 

And, eve oarsmmU ^ diott.^h»ke^4l» feagt *vT 
Of boarding Aw>»i Jipie trop^i ft n!| l j f pl i : » - i 
Sttthoa)iiilit(ltiy.:/jtki^ribiof.pnaE.; ■-> » T ' 
Muft by ch«,ii«Bgry w|ur tto.fitd upqo.r^i« •« . ---:A ' 
Ufe our corapii^oD jct>iAs jitmoft forot. . «* r . i ' 
Fddir, ^, beiOilfk 4licl: panditL fl»tt MC diiyMfie* 

'When gpM:4a<^01yflhbii^ iw ia oarne ttft ■ : * —1 ' 
I ieav4ijp9iChigimer«;.SRani^^ I will pray ^ ' 

itf eve^^lilineiqbtf;iabe.boly} . it^ui'-' • 
^or YOur fair bSeofi^i kifs. your band^' - ^ ' 

Come hjftm Bdm^ .O my ggotk ffcii/l^rj • O^ 
We o^f^tiictJBwlu jviibiii c^ tnA^^dtt^ f'M * 
There u a fbql cquntft tfacclier crcdtMV'^ ^* "^'^ ^ 

Aiytoiiih idv^otagQiiiaML to pay tby laycs^ ^ ^ 
And, j^r tAod frrnd^ iii}^'TQluiKary mftk fT ^ 

Lives la tiMMooi»:devi]r ebetifiied. v . r ' ' 
Give 9itlqriMttdi^l hiit^Mng to&f.«»«. . * ' 
Bat 1 iriU'iiikilriibi kam basRt tiiQe^.«v ;. - ^ Ik 
By hijiinii JMmi iSlrtaikMfr aiiiam'ft»v 
To <ay wMl^^gwcUd^B^ tore of Jbce^ 

:* av J" 

•«i^»1m to prey on tte walth aady^u-ofr^MK^.y ^itvu- 







Mtk. Itmmattbmmimifoyaar l i Mm :'' * 
Bqr liwa iak faife-— and cn» daw ix^« 6 lloir, 

Tbt fim » i»il|e haii;v^i,'Wit&e pfMd dtf^ 
Attended wkb tlK pkdiMI vf-tbc irarid, 
Is all too wuaoB, aad l0o4UI of gawih, ' 
To give ne lodkooi. ■ If che AidHight tielT 
Did wkh hb iran toogoe and brazen ladiMfi 
'SoiiodoMvnodiednwiriiceo^f^gjlRi: - 
If this taof wore a dMmlMrd «li«r^NrlftUkI, . 
And tlioa poflcffled witlr *<S i iiitoLl ^Wttgji| '^ ■ 
Or if tliaclgriy fririt NfebnchQlf '- >:-'-j-. 
Hadbak*dchy l>k»d and inilo it hmyHlilck) ^ 
Whkhclie^rans tickling tip aad doim tbt iFeu% 

AV9NpVv*^VflM* Vv^^BBs ^WV^^^^^fr ^HvVvflKjiSBVvA ^BN^vfll^ v^WVVBv ^'^T^'^^fe 

ibri tfpk tfacir choeks t^ idi^ 
(A paffion hatefiil «o my porpoAi) ' v ' ^^ 
Or if tto dwttoottldft fee iiic rnnhmtsfm^^ 
Hear aifc %iteitt ^thtoe am» ^tid ttdkt «^ 
Wklioiit a MpgaB» ufi^g CBOoeit tlooe, 
WkhoQt CMi, ean, and iMoftil 6aad of woriit 
TheiH m de^i^ €f hm«<y U tnttchM Ajr^ 
I would into cby bdbm pov mf dioi^glKI: ' 
But ah, I ^flUiar''---^-feti Idfve^hee ^MSV ^^' 

And, by my tr€Cb^ I diiski AM bv^ me'Mlfc 
£ftr». Sowdt^itowiM?i»lMd 

Tho' that my.doiib woR wijatfitm 0^1 tfft^ 

By heaVn, ?d do'L 

K. 7Afe». Iloiiot I iMvr^iiiMiifrorft^ - 

Good BAert, BMert^ IBtSift; M>witaA)gfc I 

On yon young boy: III ceil tbtc^rnhfi^mff-ScMd^ 

He is a very kqpni ia mf 9mf^ - 



9 



S^mmd o»> - 

Hou m. Ff And, 



V34 '^ T^ *^''** 

And, Wftefilde^er tb1s'fo6t'^f'fttttje-^hrci-e&d,' 
<He lyb 5e«Me'«fte. -DeiR^tKou' tmlerttond'We ? 
Thou art his keeper. 

'ffi^. • And' Pll>!t6^' Mni'ib, 
That he iha^rn6t oKtfti ^Or'Mlieftj. 

K. John. Ddfth. 

^«i. My-loM? 

H«^. Helhallnbt-Kve. 

K. jan. -Enough. 
1 could fje"Hjer?y lid w. i»«lr/,fnofe't»te5 
. WeU, nihdtfiy-lnrhiit'rintfedd fbt'«h«6: 
ReiiietnEiier :— ^adatn,- fk^ t(^ '^'^It- 

rU feqd thofc pdw'Vs'xfefllo-ytHir^IlllajcJly. 
££.• My'b1fiffing'go'*Wtth' thee! 
• K.JoBn. Fbr £«|r<flW, ^cbWin, '^. 
A«^«r^ (halFte jroiir taatn/lfKtteAd oivyou 
With all trae'diity $ tE>n;c^^v^hfiCllAlfVho! '[%MM. 

^ 'C fe 'N ''IS *VI. " 

K. PMi^C Of by 1 roaring tempeft on the fiood, 
O 7 A wbol^ Armado of colle&cd &l 
Is fcatcer^d and disjoinM froti> fellowlbip. 

for theDorpofe in hand, wai, I do not qdkilion(.il y^tf^iAk^ 

when the^&y im £rft ffe(hefaMcd ;/«^c}i wal i witef -or tMtt 
inoft» ;Jtcr the SfanjA jovafionin J 588. • It* was i|PLftlennoelike> 
wife tb'thal gloridas period* tSat Uaiejftar 6>iclQdes* his fbfii 
mt trlnm ptrnt inaiiiier. 

fiat th« Whbte j>laf &tM)imd^lth^C<^Wi4UtNe to'theOM^^dlHt 
ofa&in. . , . 



^J^HN. 435 

Pand. Courzm and cpmFort,' all (hall yet go well. 

K/PbiRp. What can go well, when we nave run 
foill? ' • ' '^ ' ■-' 

Arc we not beaten ? Is not Af^er% loft ? 
Arthur ta'en Prjs'ner ? diverfe dear friends flam ? 
And bloody England into England gone, 
0*er-bearing interruption, fpite of trance ? 

Lemi. What he hath won, that hath he fottify'd : 
So hot a fpeed with fuch advice di(pos*d, ' ' 
Such temperate order 'in fo fierce a courfe. 
Doth want example -, who hath read, or heard. 
Of any kindred aftiori like to thfs ? ' 

K. ?mp. Wcfl could I bear that Ertghni had ttut 
praife, ..-,... 

DO we could ^nd fome pattern of our flianae. 

.£iil^ Cpnlh^nce, 

Look, who comes hereP a grave unto a feul^ 

HoldingUh* eternal Ipirit ^gainft her will'. ^ r 

In the vile prifon of affliAed breath ; 

I pr*ythee, lady, go away with me. 

Conjtn, Lo, now, now fee the ifllic of yoig* peace.- 
K. Plnlip. Patience, good lady \ comfort^ gentle 

Conjlancel 
Qmft. No, I defie all counfel, and redrels, 

B^thaCs which ends all counfel, true' redrefi,^^ 

Death, death \ . oh, amiable,, lovely death ! 

Thou odoriferous 'ftench, found fottemttls, * ' . 

Arjfe forth from thy couch of laftiog h^htt 

Thou hate and tierror to profpcrfry, 

And I will kifs thy deteftable bones % ^ 

AnA put my' eye-balls % thy vaulCy bf6w*? " 

And ring thefe fingers with thy hdulhold worms | 

And ftop this gap of breath with fullbme duft^ 

And be a carrion monfter, like thylelf i 



9 ^'-^ tH fi fUrt$a «;av9bJ Wc (hould read coui«i, 

i: #• mardi. Tito Qxfiri Editor condefcetids toi ihu emendcclDik 

• F f 2 * Come, 



436 King JbHUl 

Come, grin on me, and I witt think fillDu^'AtttPft^ 
And kifs tlice as thy wife^ mi&r|'s fovit^Y 

comeio mc! ; /.{ : r 

K. Philip. P fair ai&t&ion, peaee. n - 

Cbifjf. No, no, i willjiot, fattving-imath (o cry i 
O, that my tongue were in the tfaund^s mouth, z 
Then with, a paflion I would fl»ke the. .Wivld> ^ - - 
And rouze from fleep chat kW anatooqc*. ^ . . 
Which cannott hear a Jbdy's fttbk tokS»ijr > 
And ieonnara faooderadnwcacion. 
Pand. Lady, you, uttf r madnefs, and io^Sxn^w^ 
C<){i^.JTiA»rart not. holy tobdie aue^t} . 

1 am not mad ; thi& hair I tear is mine i *<^ — r - 
My namcfiS'Gr^tfizfif, I ,^as Ctffrefs wikz - i 
Yourig Artimr is xny fom, and he is loil! 

I am nor mad ; I would to heaven, I were ^ ^ f 

For then ^is like, I (hould iotffic myk\L ./ 

Oh, if I could, what gr jef dbould 1 foi^ t ' / 
Preach fome pjiilofophy to make me^ Aiad#r 
And thou ibalc be canonized, CaDdiaal;: < ^r. W 
For» beaog not mad, but ienfible of g^iel^ . - ■^~^ 
My reafonabi^ part produces realbn 
How: I may be delivered of thde WQes» 
And tncbes me to kill or hang myleHL r* 
If I wetemad, I (hould fot^jccmy fott, .. ; 
Or naadly think, a babe of clouts were h/bd \ 
I am IMC ffiad4 too well, too well I (^ .: 
Hie different jplagiK of each calaink|r4 .. 
K. PbiRp. Bfnd up thp& tceflea.; 0,^whttt love I 
nofc 
td cbe &ir mukkodeof thofe her haim^ ^ 
^^Hfeere but by chMoe a fitver dcop hadl^fidl'lnt - * 
%^*n to that drop tea ihouftnd wiecgF frieiid^ « 

Do glcw tjiem&iyes in Icdibfe grkf^ j- - i i / 1 
Xike>fi«4»ikiiepaifrfikb^^^ loves» 
Sticking together IfnailaisfiqfSii; j^ui ej i-^.»r W 

C^^. Ta £4riteiif» if yott «iILMd-rw . O 
• - VLPbiBf. 



King: } o H M. 437 

KrPilt^i Vfbd up your hairs. : -•' 

Conji. Ye>/<4uiC f will ; and wherefore will Ldo it? 
t tore them from their bonds, and cry^d alaud^": • '^ 
O, that thefe handsxoold fo redeem my ibn» ' ! 
Ai Ihey^liai^ gif ^ thefe haics their libo-ty K \ T 
But n6w I eifVy^at their liberty. 
And will agni^ tommk them to their bonds 1 ^7 
Becaulemy pojtirchild isapriibner, :,.^. b 

And, father. Ou-dinal, I have heard yoa iay^ r ^i^ 
That we (hall fee and know our friends in heav'o ^^ 
If^that be^ i fliail fee my^boy ag^in. 
For iince xhe iiirth of Cam^ the firft ma]e-diiU|» _ 
To him that did but yefterday fufpire, 
There was 4)ot |uch a gracious creature born. 
But now will canker forrow eat my bud^ ^ 
And chaft^4he itative beauty from his 
And he will kxik is hollow as a ghofti 
As dim ind meag^ as an ague'is fit ; 
And fb h^^lidie; and, rifmgfo again, 
When I ihairmeec him in the eoort oi 
I fliall not^ki^n^htm ; therefore never, vpnai^ -r^ 
Muft I behold my pretty jfM»r more, r -o^s:\ \^i^ 
Pond. You'Mdtoohc^usarefp^o^'^s^^^ 
Conft. He MkA tt>,me, that ttever faad^ibro ^ ^^ 
K. Pi«/x/>.<Ycru aneai^dof gtief, at af your iMKL 
Qm/i. Oift£f»UBthe^ro(tairapofmy4bfipto 
Lyes in his bfadi^ walks up anddowi mAn»i nu 1 
Puts on his pl^^cxdcsr ftpaui^l^^^^^ dfiT 
Re6AefAttersiiie.(C4}|:httf glaqio^ : -1 

Stuffi out his vacant garments with his form 1 
Then have IsMftfon to bl^if<^ ^bfegricC; ^^^ ^ - * 
Fare voii «telt4 hadyodiSbh aPio&a|J,?L^ci -.:):*^ 
I could gim:batttr confiAm than^y^O'dd^ '' ^' 
1 wiU not keep thill foffi(^iri|d» my 1^ 

When there is fuch difitfdo^itf^iny^wit, 
O lord, nay boy, my ^i«ir,:my lair ion I 

Ff$ . Mn 






43^" iCing Jo HtJ. 

My lifci my joy, my food, my all the world 1 
My tyrido^-;comfort, and my forrow's cure! ££*!/•, 
K. Philip. I fear fomc outrage, and VU follow her, 

SCENE VIL 

Lewis. There's nothing in this world can make roe 
joy; 
*^ Life is as tedious as a twicer-told tale, 
• Vexing the dull car of a drowfie man/ 
A bitter ^aipe hath fpoilt the fweet world's tafte. 
That it yields nought but fhame ind bitternefs. 

Pand. Before the curing of a Jlfrong difealc, 
Ev*n in the iftftant of repair and health, 
The fit is ftrongeft : evils that take leave. 
On their departure, moft of all (hew e^il. 
What have you 16ft by lofing of this day ? 

Lewis. All days of glory, joy,' and happihefi, * 

Pand. If you had won it, certainly, you had.- 
No, no i when fortune means to men mdft* good. 
She looks upon them with a threatening eye, 
•Tis ftrange to think. how much Kmgjohh hatKlo(( 
In this, which he accounts fo elearly won./ 
Are not you griev'd, that jfrtbur is his t)lp)fSnef ?" 

JLewis, As heartily, as he is glad he hath htm, 
' Pand: Your mirid is all as youthful as y*o;ur ^Tooci. 
Now hear me fpeak with a prophetick fpTn 1 5 
For ev*n the bheath of what I rhean to Jpeak 
Shall blow each duft, each ftraw, each little riib. 
Out of the path which ifhall dire6Hy;'read 
Thy foot to Erjglavd*s throne ; and thercfSrc pikrk« 

?obn hath feiz'd Arthur yiwd if cannot be^ * ' ' 

hat whilft vterm life plays in'thit infantas veios^ 
The mifplac*d yehn fhodld entettmain.hoiir, 
A fnintltt?, nSy, one ^uifct Breath, of reft^ 
A fcepter, fnatchM with art unnify haridJ 
^Muft be as boift'roufly rpjMntam'd;, as g^M; 
■^ ^ - ** And 



** Andhe, thacftaqdsup9na.fljppr77.p]a^, 
*• Makes !)>(;$ of no vite; Md to . ^»y h jcp up." 
That John maj§ l^andj, then jU^buTi neg^ auub &^ > 
So be tr, for it caiuioc be bpt io. - -• -, 

Ltwis. Bmc what, ihjUl ij g^P by:.yqaBft<4fc%r',^ 

May then ni;^ke all the. (^a^ig that '/frtfi^f, did. 

Zrau'i. Andlofe.i^ PCi.a^all, a^^^i^rd^. 

Patui. Horn, gfom jfq^; ^c^ «iid. fr^. ifl t))i% o^ 
world ? 
7fli« ]^ yi9ft plote.;, the d^^pgpfRirfe «i^ y(^_ 

For he, that ft«ps h^«»f»f«tx ><>. «l?i«.W994 . 

Shall $1)4 but bjoody ^ofy apd; ftgtsfi^ 
This asa,. ft> evilly bpfo^ 1^)1 coftl^thth^^gj 
Of all his E?cj>le, ap4 ^ee^e. up. tji?ir 5«|A j. 
T*9Sfn<j fo. finall.^^ww^ilfiCi ^1 te ferd^ 
To.qhcck bk ccig^ bffi «^ w.yi c^cri^x ife 
No hat*ral exhalation in the sky, 
' NouUcaoc-of n afiT. no. difletnoec'd <^ay- 
No common wind, no cu domed event, 
^c they y^l pIiK^;ai^7 its n^t^ral c^Olei 
And call them meteors, prodigies, and figns^ 
Aborthfes, aad prd^L^, fjon^es of heav*n 
Plainry denouncing vengeance upon Jobn.^^ 
Lewis. May bq, ke will.i^q^toi^ch young ^r/W*a 
life; ' 

Bat hold him(elf fafe iq his prifonnient. 

Pand. O Sir, when he fiiall hear of your approach. 

If that young Arthur be not gone already. 

Ev'n at this news he dies : and then the nearts 

Of allluk^plp fliaU;iidM0k from hifn> 

I ^a Tc4pc ef ^'^''•^1 ThR sirtborvciy fincjy calls zmm- 
Jtrms htrlJf^ an ^ci^ rfy^ure, h% if it wer<^ prodqm while Jlic 
watlniry elfewhere, or ineeiic oo (oin^ otKcr ihme! But tte m* 
firJt^^m will kaye it, tka( Uakt^ar wxgcr, ^ ' " "" 

Ff4 And 



AnA)(pjcl)ifh-qxigaiiatts^ df rerutt wdfi^nktk^^^ Y 
Ouc m the bloody fingers* ends of Jolm. 
Metbinks, I fee thbl^rTy all on foot i 
And O, what better Attmr-hfeeds ftl- yoi^ "^^ 
Than I have naifl^dti^^^^The biftard fiMoitMJ^ 
Is no* m(£$fgiaftd^ imfiieMng the chttrch, * 
Oficndbig dsatitjr^ If btir f^v«^e Jf^incb ^^-^ oT 
Were there in atidis, tlief 'Wtxikl be a^iT^di ^^^'^ 
To train ten thouiand EngHfi'to tktit BOii ^ ' '^- 
Or, as a little faoWtOimbled about, ' ^' -^'^ 
Anon becomrs^aMnbmciifi'. • NdU^ JiMfjtfat'l - ^^Y 
Go with,ine'CdKdieiICtag:r 'tis W6ndfei4ilt'^'^? ¥^^ >Y 
What fW]!^Wiira^kc^tiroftUdr<lfl^^ 
Now that thidr fBul^^afe'vop-fiill df ^^klSti^^^- ^ ^ 
For Effkmd g^f ^ laiiviD'wfcet ob thV>HiiigL ^ c^or H I 

If you lay ay^ Che ]tfitt'WiH4X« %«ift^q 3i:£Jjrifilr. 

* *' ■ ' *"\-^' ' " ''* "'^'"^^^ -^'-'^ -"' l it 

£ AT me thefe irontdia^ aiMicjdbirt'A oiifltta 
Wifihiti ilRainsi(t;irii^ Ubikq«^ tnc-iuT 
Upon the bofom ofofae,.8naJnd;:yii(li>«arcUsi!im I 

Faft to the ^lair: iM haedfiilf tabbc^viiiiMaiisjQ 




Hub. UqolQwdg i^rnplcs hfiwuitt ffxt tcIiMkcd!t A- 

*.^i». As iitde pripce (hayiogiagmifi.atiile:\ ^ 
To be moif 4^cii|pe} ^#^imy .be; You ate fuL : - . 
Hub. In^^cU l^wetbeeo.iixnrkr. ; r T r « 

Klethioks, no bod; CbpuH be iad butl^ ... 4^ ^ .. 
Tet I rcMMBtRE'^w I wmmJrMct4,.iur:.j - . .^^ 
Toufig geiii||Mnff)( would be <a$^^ asiiig)it,i ^ ^ c C 
Otaly mriwiKWQers, BytnyHchiiftcffdo^ai^ ^.1/ 
So were IrOliTiof prifQ^^^uvlrJ^ptlllecp^ 1 :tf:.b v,c V; 
I (houlcf 1^ tKMfjM theilajr is.kMQi^ : AtA^n;^ ic/^ 
£4%)d i9i Im^ be.ba-Ci .iw 4bii^ 1 4o«iiit»ci^ i 

He is afiaiid of me^ and I of bim. 

JU it my fanhj tha^ X* waa-G^^y^a Am I — »— - 

Indeed, it is not; and I would to beav^o^ 

-J yrpx y^r jfisii, ^ you: would love in4 Hi^^* 

Hub. If I talk to hiiti, witb his ioiiOGent prate 
He will^mj^ my messcyf whiph lyeii}iiad» 
Therefore I will Be iudden^ and dilpaich. ^ [jifidi. 

Arih. Are yoi^fick, Hi^t^, youlook pale to ^y 1 
In footh, I wou'd, voii were a littte fick ) 
That I might fit altnigl^c ^nd w^ch with you^ 
Alas, I Ibl^ytSii More than ydii do ibc. 

H$!b. His words do take pofleffion of my bofom* 
Head hi»c, young AAlSki ^ ^ * - \Sbimfig aMur. 
Klftw^^iwtf Ahltflvirlwiihitf io li '>^> - TA '^ %W^^ 
Turning i^pitaite(«^rintiimwtJ6f dotel^ ^* 
I muft bo4Bi^ k$&KMi§ioa "^ 

QvMtiibiQtefieKiirM^c^ triail i . i ' 1 ■ 

CWyoA liMjitidrkf MikMi fidr wnti v 



442^ K^g JOTHN, 

Jrtb. Ttxy feiriy, mber^j for fo foul effedL 
Muflr^ou with iron^btirn out boch mine eyes? 

Bub. Young boy, I muft. 

^r/6. And will you ? 

//«*. And^ I will. 

Jrtb, Have you th« h«ut ? when your head did 
* bat ake, 
I knit my handkerchief about your broiKKS ; 
(The beft I had, a princcfs wroughtut rac) 
And I did never a^k it you again ; 
And with my hand at midnight hdd yow hotuk^ 
And, like the watchful minutes to the how. 
Still and anon chear'd up the heavy tii»e» 
Saying, what lack you ? and where tye» your ffi^ 
Or what good love may I perform for you? 
Many a poor man'ls fon would ha^^e lain Ml» 
And ne'er have fcoke a loving word to^you^ 
But you at your ncfc fefvice h^ a prince. 
Nay, you may thihk,.my love was craifty' Icwe, 
And call it cunning. Da, an if you wSl : 
If hcav'n be pleas'd that you muft.ufe m« UJ, 
Why then, you muflf— — Will yoo put out minf 

eyes? 
Thcfe.eyeS, that never did, nor never fltatt^ 
So much as frow^n on jrou, 
• Huk Pve fwom to do it ; 
And with hot irons rtiuft I burn them dnt. 

Arfb. Ah, none, but in this iron age, would xfe iCb 
Theironof itfclfjiho* heat red-hot, , 
Approaching near thefe eyes, would drink my tmn^ 
And quench its fiery indignation, 
'Even in the matter of mine innocence: 
Nay, after that, tonfiime away in ruft. 
But for containing Are to harm mine eye, 
Afe you more ftubborn-hard, than hammer'd ifoo I 
Oh ! if an Angel (houfd have come l»'me, 

And toltl me, AirAfrrftooN put tMic miMr qmi 

I 



? I would not have bdiev'd him: no tbhgti<i Bdlf 
Huherfs'. 
Huh. Come forth \ do, as F Hid yt>u. 

[a/xMjI^i's ^^ the iHitt^HttT^ 

^ Arib. O laVertc, Hnher^t^ fave rtic ! nly cyts att-onti 
Ev'n with the fierce looks' of thcfe blood/ men. 

Hub. Give me the iron, X fey, amd'Bind him hewf. 

Artb. Alas, what need you be f6*boift*rous-Tough ? 
I will not ftruggle, I will ftanc* flfcmd^ftill; 
For hcav'n's fakd, HtAm^ let me* not be bcnfadi ' 
Nay, hear me, Hubert^ drive theTe liieri away. 
And I will fit as quiet a^ a lamb. 
I will not ftfr, rior \^lncei nor fpeaK a w'drcf. 
Nor look lipoW fhe iroA angrily : 
Thruft bat tncfe men awiay, and PlFfor^veydu, 
Whatever tormtint yoii do put me to. 

Huh. Go, flfarid Within 5 let ihe alone with him. " 

^xic. I sritt Bcft pttas'd tb' be frcfm fuch a deed. ' 

{^txeuni; 
. Arth. Alas, I. then have chid afway my fridiid f 
te hath si ffern Ipok, but a gentle heafrt ; 

it him come badk,- tfiat his compifti6n m4y 

I I nvouldnkt have htlie'ved a tongue BtiT Hubert's. J 'f*hai 
Mr. Pope found the line in the old cdltioM. Accordhrg to this 
reading jt is fappoftd that Hater t had tcjd him, lie v^ovkt ««/ piK 
out his eyes ; for li^t stngel who (gn% h^ mmtid^ is brought in at 
contradidine Hntert^ Mr. Tbeoia/a, by what authority I don*t 
kQo\y, res as, 

• ' / wodfJ not hafoe hHehf^d him : lio tongue, Bui jtfdbef t*j. 

which is fpoiling the txleafdre« withoot i&Qch li^ehding iht Sen(^. 
SiaJkeJ^ear; I am perfasided , wrote, 

Jnvou/dn^ banje Selieved a Iw^i ^HATt KvBiRTr 

h '• abate, difparage. The bhinder leems to hacve arifeti ^m^ 
hate fi^nifies except, faviog | fo the tranfcribers» taking it in thii 
fenfe, fabftitated the more ufual word iut in its place. My alte* 
ration greatly improves the fenfe, as implying a tend^rfadi of al^ 
fcAion for Hkhtrf ; the common readings only sm opmkiii of Hih 
herfs veracity ; whereaa tlie point hefc wat to win upon H»birfk 
pai&ons. wKich could not be better done than hf ihewiag afidion 
ifcwai-ds him. ■ 

Give 



444^ King | 6 H Ki 

Give life to yours*; - >. : : * Sl^r^: .: . v -^ 
Uih. Comc» hoy,prfipfiirc^yborfeIf.-- i 

: jfiW. Nunc, l^wtito Iqfe your eyes. ^ ..*.x 

Jrtb. O heav*n ! that there wtre but a mechtiiyMvi^ 
A grain, a duft, a gnaiy a wandring hair^ ^. 
Any annoyance in that precious fenfc : . :- Y 

Then^ feeling what fmaU thng^ are boiftVoos ibeni^ 
Tour yile in^ot mud needs icem horrible. * 
Hub. Is this your promife ? go< to, hold yoor 

* tongue. r 

jfrtb. Huhift^ the. utterance of a/braoeiof toogoes 
Muft; n^seds i?aot pleading for a pair ofiieyes : .. 
XA;;.0ie,not hold mf. loogutf : Letmejio^v^Aflfc^/^; . 
Or, Fiuberiy if you will, cut out my tongue. 
So I may keep mine eyes4 P /pare m^e eyes ! 
Though to no ufe, but ftill to look on you. 
Lo, byjnv4roth, the in(bni9IQ(it « ^9^.. 
And would hot harm me. 

^ ,,flitf^. I can heat it, bqy. ,:..^^^ 'vi\^^ 

' jirfb. No, in good fooch,, the fire is dead with gr»« 
Being create for comfort, to be u$*d ^ 
In jundderv'd extreams \ fee elfe yotAS^ - *? 2i 
There is no malice in this burning coalA .-^ 
The breath of hea^n hath blowa ics>^ik'^«ftt» ~ r.A 
iBmi ftfew'd repentant afbes an its head ' ^ •' *^ ^^ 
Hub. But with my breath I can reirtirib^it^ boy. ^ 
, Artb And if you tk), ^fxm will btu t^t it feldlK? 
And glow with (faame df your pnooeedii^i Mlibmr^i^ 
Nay, it, perchance, wiMipafkte in yo«r ^M: ^ -^ 
And like a dog, that is^compell'dto^^gii^ f^ "^K-'y 
Snatch at iw timfler that d^cli fane him lAi. ^ • ' ' 
Att^^ng^: tkatiyoo .'ihiiuld ufe co^do^^lM ttrrong^ _ 
Deny their office roAl^yoo do lack ^ 

That merci^ iivhkh fieccetire and iroirextend. 
Creatures of note for mercy-lacking^ i^ea:^ 

Huh. WtH, fte to livci I wiH tM vimkMt^^^ 
'jyj '' For 



( 



King J b H K^ 445 

For all the treaTure that thine uncle OWBs! '^' '\ J 

Yet am I fworn j and I did purpofe, boy. 

With this fame very iron. to barn them out. ^^ 

Artb. O, now you look like Hubert. All this while 
YtNt ivere xli^uiicd. 

Hub. Peace: ix>nioPc. Adieu, 
Your uncle muft not know but you are dead* 
?ll fill thefe dogged fpies with falfe reports : 
And, pretty child, deep doubtlefs, and fixnire. 
That aaberU for the wealth of all the world. 
Will not ofiend thee. 
: Artb. O hcav*n! I thank you, Hubert. 

Hub. Silence, no more ; go clofely in with me. . 
Much danger do I undergo tor thee. [Exeunt^ 

SCENE n. 

■ I- • 

CboM^i fa tie CiUrf of England. 

^uter JSSt^ John, Pembroke, Salisbury, and tfber 

Lords. 



f fc-*« • 



K. 7gfar.TT£R E once again we fit^ onoe ag^ 

JL X crowned. 
And lo^'d u^^ I hope, with chearful eyes. " 
Pemb. Thill: onoe agsio^ bve diac your h%hne& 
pjeasyy. 
\inis once fti^f ffalous ; you weie cniwn'tl befbre^ 
A^^d^ high royalty waSfne^er pluckM oSt . i 
The fki^hs of jomi ne'er fta^noi^itfa cotroiri ,n 



i "j,^. : 



t K- 



^^ 



Frelh expc^ion troubled^ not the land 
With any long'd^for change, or befter&tte^ - i r>i.. 
^ Sd^ Therefom tOtte pofli^ iwicbidoubte 'ptmp^ 
Toguard a titlclthat was i^cdftefpnefR ' -J 

^\o gild rofined goH,^ co paiiitthe lilljr,^ m u 
•^^To thrown pcrfumifc qn she wlctv o '.-^u ^^^^^ 

H 1^ imonrii; file idr» <lr aiU and^ >^V' 

^ Unto 



M^ tf% JfOH-i^: 



ic 



" Unto the.rainbaw, or with tapcr^liafet 

*• To feck itlie bea^uteous eye 9r heaven tQ^g^niih,^ 

Is wafteful and ridiculous excels. 

.Pemb. But that your royal pleafiJU'e muft be,4onc» 
This aft is as an ancient tale 'new. told. 
And in the laft repeating troublefbme,; 
Being urged at a tkne unfeafon^ble. 

SaL *';In this the antique a^d weIInno(ed^£iQe 
•• Of plain cdd form is much disfigured i 
" And, like a (hifted wind unto a fail. 

It makes the courfe of thoughts^ to fetch about ; 

Startles and frights cooHderaf ion ^ 

Makes found opinion (ick, and truth fufpe^led, 
" For . putting on fo new a fafliion*^ robe/* 

PenJb. When workmen - drive to do better tbtn 
well. 
They do confound ^beir * skill in covetouihefs ; 
And oftentimes ^xcuBng. of a fault 
Doth -make the fault the worie by the cxcufe : 
As patches, let upon a little breach, / 

rDifcredit jnoro- ' ia hiding of tht flaw^ 
Than did the flaw before it was fo patch*d. 

Sal. To this cfFcd, before you, were njw-crpwa-d, 
We breath'd our counfel i but it pleas'd your highnds 
To over-bear it ^ and, we're all well pl^'4 > 
. Since all and every part of what.. we would. 
Mult make a ftand at what your higlyieis will. 

. K. John. Some reafqns of this, double <;orpmi||s 
1 have .pofleft you. with, and think .thcn^ ftro^gT 
And more, more ftrong (tjic k;fl;er k my fear) 
I fhall endue you. with : mean time,, but ask - 
What you would have rcform'd^ that i$ not wcll^ . 

a -*— »/ii7/ Iff oovetoafnefs ;] i . e. coveting to r^ck- m higber 

excellence. .^,:,. 

3 '^'^^in Mifigtf tbi fault, 

nan didibi FAULT ■ ■ ] .We ihonld.iild.^^A W^tllkod 
places. 

And 



{ 



King (J b H W. 44.7 

And well flmll^jou perceive Jhow willifgty * 
1 will h&tht hear^and grant you your requens. 

Pemb^ Then' I, as one chat un the tongue of tbc% 
To fttind the purpoies of all their. hearts, 
(Both for myfelf and them ; but chief of aUf 
Yourfafcty; for the which, myfelf and th^y 
Bend their beft ftudies ;) heartily ropieft 
7V jnfiranchifement of Atrtbur \ whofe reftrainC 
Jk/dh move the marm'ring lips of dilconcent 
To break into this dangerous argument ; 
If what in reft you have, in right you hold, 
'Why fliou'd your fears, (which, as they fay, attend 
The fteps of wrong) then move you to mew up 
Your tender*kinfflf)an, and to choke his days 
*With barbVous ignorance, and deny his youth 
The rich advantzige of good exercife ? 
That the timers enemies may not have this 
To grace occafions, let it be our fuit. 
That you have bid us ask his liberty ; 
Which for our good we do no further ask. 
Than whereupon our weal, on you dependinig^' 
rCoimts it your weal, that he have liberty. 

Enter Hubert. 

K^Jobn. Let it be fo ^ I do conunit his yooth 
To your dircftion. Hubert^ what news with you ? 

Peni3>. Tbisas the man, ihould do the bloody deed : 
H^ fliew'd his warrant to a friend of mine. 
The image of a wicked heinous fault 
Livts in his eye ; that clofe afpeA of his 
Does (hew the mood of a much<»troubled hrctft. 
/'And I do fearfully believe 'tis done. 
What we fo fear'd he had a charge to do. 

Sal. The colour of the King doth come and go. 
Between his purpofe and his confcience, 
Like herakis 'twJxc two dreadful battles (fi)ktti : 

His 






448 tSllg JOHH. 

Hit ptflioo is (6 ripe it needs muft break. 

Pemb. And when it breaks, 1 fear, will iffiie theaot 
The foul oomipdon of a fweec child's death. 

K. ypht. Vfc cannot hold mortality's ftrong hand. 
Good loids, although my will to give is living. 
The fuit wfaidi you demand is gone, and dead* 
He cells us, jfrtbHr is deceased to night. 

Sal. Indeed, we feared, his ficknefs was paft cure. 

Pemh. Indeed, we heard how near his death he 
Before the child himlelf felt he was fick. 

muft be anfwer'd, either here, or hence. 

K. Jdm. Why do you bend fuch folemn browt 00 
me? 

you, I bear the fhears of deftiny ? 
Have I commandment on the pulfe of life ? 

Sal. It is apparent foul-play, and 'tis (hame 
That greatneis ihouid fo grofly ofier it : 
So thrive it in your game, and fo fare wel ! 

Pemb. Stay yet, lord Salisbury^ Vll go with thee^ 
And find th' inheritance of this poor child^ 
His little kingdom of a forced grave. 
That bloody which own*d the breadth of all this iflc^ 
Three foot of it doth hold ; bad world the whilej 
This muft not be thus borne ; this will break cue 
To aU our forrows, and ere long» I doubc 



SCENE m. 

EtUir M M^ef^er. 

K. John. They burn in indignation ; I rcpcflL 
There is no fure foundation let on blood ; 
No certain life atchiev*d by others' death — [Afi^* 
A fearful eye thou iiaft i where is diat bloody 

\To the Mt^a^er. 
That I have feen inhabit in thole cheeks } 
So fotti a skv clears not wkhout a Aorm \ 
Pour down cby weather : how goes all in itvom ^ 






Mef. Fj;ot^fl^antet6 Bf^nU never' Tufch a jpdwer^ 
PBFzny foreigh ^repctnrtbh, ' ^ , ' - 

Was Icvy*d*m'the body bf aland, ^ . /r -• 

Tfic copy t>f your fpecd is leariiM by them : 
For wbenyou ihduid be'tbld^ they do-preparc, 
The tidings^ cortie, that they are M arrived, • . * 

K. John: 0,;«vhcre hath oiir intelhgence* been'drunt f 
Whesrc Hich jt fiept? ivhel-eis tny ftiochf r^s 'Car e ? 
Tllat fuch an army Ihou^d be drawn in France^ ' 
And (he not hear of it ? 

' Jl*/. My Liege, her ear '• t •> 

Is" ftbpr Wirfi dtift \ the 8f ft bf ytpril, dy M 
Your noble mother ;> and, as 4 hear; my lord, , 
The lady Conftance'm a frenzie dy'd , . " . \ 
Three days licfore : ' but ihis from rumour'is tongue 
I idlely heard ; if true "of ftlfe^ 1 know not. * { 

K. %bn. With-hdld <hy ^pccd, dreadful occafion I * 
O maJce aicague with trie, till I have pleased . / 
My diibontented peers. What ! mother' dead f ' 
How iMldiy then walks myfeQate in Pranc^ ? 
Under whofe conduft came thofc powers qF France^ ^ 
That; thou ibir tPuth giv*ft b\xi^ are land&l here ? ^ 

Mef. Under the J[)tf»^W»,^^ ^ • -j 

• • • * ■* 

— —Enter: FaWcpnbridge, ^^Pttcr of Ponftftet. 

K. John. Thou haft made me giddy 
With thefe ill tidingsT Now, what fays the world 
To your proceeding|i?t' '>PM aotieek to ftuff 
My*tiead with xxioip ill nvff^ for it isjftill. ; '*• - 

Paul. But if you bf a|r^ic] to l^eai' the-worft^ - ^ 
Then let the worft unheard fall on yoUr fa^ad^ ^ ' 
^K. ^obn. Bear with me^ CouGniii^ I was amtt*<| 
Under the tide ; - but now I Breath again 
ATofc the flood, and can .give auffer^ce • • ' • *-; 
To any tongue, ibcak, jt of what it wjJL - v - ' 

Faulc. How I nave iped an^ong-th^ clirgftncA^ ' \ 
The fums I have colfe^^ fliall exprc&. ^ ' ^ 

-Vol. III. Gg .^ i 



4jOy JCwg John. 

But as I travcird hither chro* the land, 
i find the people flrangely fantafied i 
Pofleft with rumours, full of idle dreams s 
Not knowing tvhat they fear» but full of fear. 
And here's a Prophet that I brought with xne 
From forth the ftreets of Pomfret^ whom I Ipood 
^ith many hundreds treading on his heels : 
To whom he fung in rude harih-founding riiimes^ 
That, ere the next Afcenjiofhday at noon. 
Your Highnefs Hiould deliver up your crown. 

K. 7^6;i.Thou idle dreanKr, wherefore did'ft thoofb? 

PeUr. Fore-knowing, that the truth will fall out ^. 

K. John. Hubert^ away with him, imprifon hina. 
And on that day at noon, whereon he fays . 
I fhall yield up my crown, let him be hanged. 
Deliver him to fafety, and return, 
Ftor I muft ufe thee, ■ O my gentle coufio, 

[Exit Hubert, wUb Peter. 
Hear^O: thou the news abroad, who are arriv'di 

Faulc. The French^ my Lord \ men^s fnoitths are 
full of it : 
Befides, I met lord Bigot and lord SaUshUry^ 
With eyes as red as new-enkindled fire. 
And others more, going to feek the grave 
Of Arthur^ who, they (ay, is kilPd to nighc 
On your fuggeftion. 

'K..yobn. Gentle kinfman, go 
And thryft thyfeif into their company : 
1 have a way to win their loves again : f 

Bring them before me. 

Faulc. I will feek them out. 
I K.Jobn. Nay, but make hafte: the better foot 

before. 
O, let me have no fubje& enemies. 
When adverfe foreigners affi*ight my towns 
With dreadful pomp of ftout invafion. 
Be Mfrcury^ fct.feathera to thy heels \ 
( .. And 



JTwgJOHN. 451 

And fly» like thought^ from them to me again. 
Faul€. The fpiric of the time ihall teach me fpeed. 

K. John. Spoke like a fprightful noble gentleman. 
Go after him \ for be, perhaps, (hall need 
Some mdOTetiger betwixt me and the Peers i 
And be thou be. 

Mff. With all my heart, my Liege. [£x^; 

JLJobn. My mother dead 1 

SCENE IV. 

EfUer Hubert. 

Huh. My lord, they fay, five moons were leen to 
night : 
Four fixed, and the fifth did whirl about 
The other four, in wond'rous motion. 

K. John. Five moons ? 

Hub. Old men and beldams, in the ftreets. 
Do prophefie upon it dangeroufly : 
Young Jrtlmi^^ death is common in their mouths i 

And, wlificn they talk of him, they fhake their headsi^ 

And whifper one another in the ear. 

And he, that fpeaks, doth gripe the hearer's wrift, 

Whilft he, that hears, makes tearful adiion 

With wrinkled brows, with nods, with rolling eyesi 

I iaw a fmith (land with his hammer, thus. 

The whilft his iron did on the anvil cool. 

With open mouth fwallowing a taylor's news ; 

Who with his fhears and meafure in his hand. 

Standing on flippers, which his nimble hafts 

Had falfely thruft upon contrary feet. 

Told of a many thouland warlike French^ 

That were cmbatteled and rank'd in Ksnt. 

Another lean, unwafh'd artificer 

Cuts off his tale, and talks oiJ^tbur^% death/ 

Gg % K, Jtbk 



45» ^^& John. 

K. y^bn. Why ieek'ft thou to poffds me With tkefe 
fears ? 
Why urged thou fo oft young Artbuf^s death ? 
Thy haftd hath murther^d him : 1 had a cauft 
To wifh him dead, but thou had'ft none to kill him. 

Hub. Had none, my Lord? why, did yoa not pro* 
vokc me ? 
/. K. John. ^' ^ It i^ the eurfe of Kings, to be atttnded 
*< By flaves that take their hunsours for a warnuit» 
^* To break into the bloody houfe of life : 
** And, on the winking of authdritv, 
^' Tounderftand a law, to know tne meaning 
<^ Of dang'rous majefty \ when, perchance, it frowns 
V More upon humour, than advis'd relped.'* 

Hub. Here is your hand and feal, for what I did. 

K. Jobn. Oh> when the laft account *twixt heav^i 
and earth 
Is to be made, then (hall this hand and feal 
Witnefs againft us to damnation. 
^< How oft the fight of means, to do ill deeds^ 

Makes deeds ill done ? for hadft not thou been by, 

A fellow by the hand of nature markM, 
^ Quoted, and fignM to do a deed of (hame, 
•' Tnis murther had not come into my mind." 
Bat taking note of thy abhorr'd afped. 
Finding thee fit for bloody villany. 
Apt, liable to be employ'd in dangp", 
I faintly broke with thee ofAnburh death* 
And thou, to be endeared to a King, 
Mad'ft it no'confcience to deftroy a Prince. 

Hub.^ My Lord 

K. John. *"< Hadft thou butihook thy head, ormjide 
a paufe, 
*• When I Ipakc darkly what I purpofed : 

4 // is the eurfi of Kings, ftc] Tkif phiaty lllhtt tt DmvNmh 
cafe, in the afiai/of iM«ry Qa^n afSccii, and faaudtkave bdi 
inferted long after the £rft repfefentation. 

<« Or 



cc 
cc 



Xag Jonv. 453 

** Or turn'd an eye of doubt upon my face» 
** Or bid me tell my tale in ezprefs words } 
^^ Deep (hame had ftnick me dumb, made me break 

off, 
^^ And thoie thy fears might have wrought fears 



m me.'* 



But thou didft underftand me by my figns. 

And didft in figns again parley with fin ^ 

Yea, without ftop, did'ft let thy heart confent. 

And confequently thy rude hand to z& 

The deed, which both our tongues held vile to name.— 

Out of my fight, and never fee me more I 

My Nobles leave me, and my ftate is brav'd, 

£v'n at mv gates, with ranks of foreign pow'rs ; 

Nay, in the body of this fleflily land. 

This kingdom, this confine of blood and breath, 

Hoftility and civil tumult reigns. 

Between my confcience, and my coufin's death. 

Hub. Arm you againft your other enemies, 
I'll make a peace between your foul and you. 
Young Arthur is alive : dus hand of mine 
Is yet a maiden, and an innocent hand. 
Not painted with the crimibn fpots of blood. 
Within this bofom never entered yet 
^ The dreadful motion of a murderer's thought. 

And 

5 nt dreadful motion 9f a HLVJiii*ViOvt thot^bi.^ Nothing can 
be falfer than what Hubert here (ays in his own vindication ; (yet 
it was the poet's parpofe that he flMmld ^peak tnith) for we find, 
froin a preceding icene, tbe motim 9f « murd^rwus ibougbt bmd em- 
ired into bim^ and that, very deeply: and it was with difficulty 
that the tean» the intreaties, and tne innocence of Jrtbur had 
diverted and fapprefled it. Nor is the expreffion» in this xjcading, 
at sdl exaift, it not beins the neoefiary quality of a mmri^remt 
tboe^bt to be dreeiJfuU al&ighting or terrible i For it being com- 
moaly excited by the flattenng views of intereft, pleafure, or ic- 
venge» the mind is often too mnch taken up with thoie ideas to 
3t;t^» fteadily, to the conJcg u en c cs. We mnft condode there- 
five tlut SbakiJ^ear wrotes, 

■■■ ■ * a murdbrek's tbougbt. 

G g 3 And 



454 ^% J o H n: 



And you have flander'd nature in my formi 
Which, howfoevcr rude exteriorly. 
Is yet the cover of a fairer mind. 
Than to be butcher of an innocent child. 
K. John. Doth Jribur live? O, hafte thee to the 
Peers, 
Throw this report on their incenied rage. 
And make them tame to their obedience. 
Forgive the comment that my paffion made 
Upon thy feature, for my rage was blind i 
And foul imaginary eyes of blood 
Prefented thee more hideous than thou art 
Oh, anfwer not, but to my clofet bring 
The angry lords with all expedient hafte. 
I conjure thee but flowly : run more &ft. [Exnn/. 

S C ^E N E V. 
^ Street before a Prifon. 

Enter Arthur m the fFdls^ difguis^d. 

jtrtb.^nr^ H E wall is high, and yet will I leap down* 
X Good ground, be pitiful, and hurt me not! 
There's few or none do know me : if they did. 
This ihip-boy's femblance hath dilguis'd me quite. 
I am afraid, and yet Til venture it. 
If I get down, and do not break my limbs, 
ril find a thoufand (hifts to get away : 
As good to die, and go ; as die,and ftiy. [Les^sdawB. 

And ihU tmkt$ Huieri hcak trotb, as the poet inteaded heifamdd. 
He had not committed the murder, and confeque&dy the autin ^ 
a muriirir^s thought had m^tr entered his hofim. And b this lad- 
ing, the epithet dreadful is admirably juft, and in natoie. For a( 
ter the perpetration of the fta, the appetites, that hurried their 
owner to it, lofc their force; and nothing focceeds, to take poifeT* 
fion of the mind, but a dreadfbl confcioofnefs, that tonneDts the 
murderer without refpite or intermiffion. 

Oh 



XsHg John. ^55 

Oh me ! my Unclc^s fptric is in chefe ftones : 
Heav'o cake my foul» and Englajtd keep my bones ! 



Enter Pembroke, Salisbury and Bigot. 

Sal. Lords, I will meet him at Sc« Edmondsiitry i 

Tc is our fafecy ; and we mud embrace 

This gentle offer of the perilous time. 

Pern. Who brought that letter from the Cardinal I 
Sal. The Count Mdun^ a noble lord of France^ 

^ Whofe private with me of the Daapbin^s love 

Is much more general than thefe lines import. 

B^ot. To-morrow nx>rning let us meet him then* 
Sal. Or rather then fet forward, for 'twill be 

Two long days' journey, lords^ or e'er we meet. 

Enter Fauloonbridge. 

Fauk. Once more to day well met^ diftemper'd 
lords ; 
The King by me requefts your pfelence ftrait. 

Sal. The King hath difpoflcft himfelf of us i 
We will not line his thin, beftained cloak 
With our pure honours : nor attend the foot. 
That leaves the print of blood where-e'er it walks. 
Return, and tell him ib : we know the worft. 

Fanlc. What e'er you think, good words, I think* 
were beft. 

Sal. Our griefs, and not our manners, realbn now* 

Faulc. But there is little reafon in your grief, 
Therefore, 'twere realbn, you had manners now* 

Pern. Sir, Sir, impatience hath its privilege. 

Faulc. 'Tis true, to hurt its matter, no man elfe. 

Sal. This is the priibn : what is he lyes here? 

[^Seeing Arthur. 

6 JfMk ftrinfrntit &c] /. #• whofe private acooont, of the Dam* 
fbin'i afidLiOD to oar caafe, is much 190R ample (haa the letters. ^ 

Mr. F^\ 

G g 4 P$m. 



^ 

45^ tSng Jonu. 

Pern. O death) made proud with pwe afid prlnody 
beauty! 
The earth had not a hole to hide this deed. 

Sal. Murder, as hating what himfelf hath done^ 
Doth lay it open to urge on revenge. 

Bigot. Or when hedoom'd this beauty to chegrave^ 
Found It too precious princely for a grave. 
, Sal. Sir Richard j what think you ? have you beheld^ 
Or have you read, or heard, or could you think. 
Or do you almoft think, alcho* you fee. 
What you do fee ? could thought, without this objeft, 
Form fuch another ? 'tis the very top. 
The height, the creft, or creft unto the creft 
Of murder's arms 5 this is the bloodieft fham^ 
The wildeft favag'ry, the vileft ftroke. 
That ever wall-cy'd wrath, or ftaring rage, 
Prefented to the tears of foft remorfe. 

Pern. AH murders paft do ftand excused in this s 
And this fo fole, and io unmatchable. 
Shall give a holinefs, a purity. 
To the yet-unb^otten fins of time 1 
And prove a deadly blood-fhed but a jeft, 
Exampled by this heinous fpeflacJe. 

Faulc. It is a damned and a bloody work. 
The graCelefs aftion of a heavy hand : 
If that it be the woric of any hand. 

Sal, If that it be the work of any hand ? 
We had a kind of light, what would enfue. 
It is the fhameful work of liuhert^^ hand. 
The praftice and tlic purpofe of the King: 
From whofc obedience I forbid my foul. 
Kneeling before this ruin of fweet life. 
And breaching to this breachlefs excellence 
The incenfe of a vow, a holy vow! 
Never to tafte ri^e pleaftires of the worid, 
]>Jever td be infefted wkh delight, * 
Nor converfant with eafe and idlenefi. 
Till I have fet a glory to this hand. By 



lEw^ JottN^ 457 

by giving it die worlhip of revenge. 

»f^* I Our fouls rdigioufly confirm thy words. 

SCENE VI. 

Enter Hubert. 

Hub. Lords, I am hot with bafte, in feeking you ; 
Arthur doth live, the King hath fent for you. 

Sal Oh, he is bold, and bluflies not at death i 
A vaunt, thou hateful villain, get thee gone! 

Hub. I am no villain. 

Sal. Muft I rob the law ? [pramng bis Sword. 

Faulc. Your fword is bright. Sir, put it up again. 

Sd. Not till I (heath it in a murderer's skin. 

Hub. Stand back, Lord Salisbury^ (land back, I iayi 
By heaven, I think, my fword's as (harp as yours, 
I would not have you, Lord, forget yourfelf. 
Nor tempt the danger of my true defence ; 
Left I, by marking of your rage, forget 
Your worth, your greatnefs, and nobility. 

Bigot. Out, dunghill ! dar'ft thou brave a Nobleman ? 

Hub. Not for my life ; but yet I dare defend 
My innocent life againft an Emperor. 

Sal. Thou art a murderer. 

Hub. Do not prove me fo ; 
Yet, I ani none. Whofe tongue focver fpeaks falfe. 
Not truly fpeaks ; who fpeaks not truly, lyes. 

Pern. Cut him to pieces. 

Faulc. Keep the peace, I fay. 

Sal. Stand by, or I ihall gaul you, Faulconbrid^f. 

Faulc. Thou wert better gaul the devil, Salisbm^y. 
If thou but frown on me, or ftir thy foot. 
Or teach thy hafty fpleen to do me ihame, 
ril ftrike the dcaa. Put up thy fword b^me, 
Or PH fo maul you, and your tofting-iron. 
That you (hall think, the devil is come from hell. 

B^ot. 



458 fi^ Jo H it: 



Bigot. What will you do» renowned Batkmdfri^ff 

Second a villain, and a murderer? 

Hub. Lord Bigot, I am none. 

Bigot. Who kill'd this Prince? 

Hub. 'Tis not ao hour fince I left him well : 
I honoured him, I iov'd him, and will weep 
My dare of life our, for his fweet tife*s lofs. 

Sat. Truft not thofe cunning waters of his eyes» 
For villany is not without fuch a rheum ; 
And he, long traded in it, makes it fecm 
Like rivtrs of remorfe and innocence* 
Away with me all you, whofe fouls abhor 
To* uncleanly favour of a flaughter-houfe. 
Fur i diw {lifted with the fmell of fin. 

Bigoi. Away towr*d Bury^ to the DaupbiH there. 

Pern. There, tell the King, he may enquire usout. 

[Excmta Urdu 

SCENE VII. 

Faulc. Here^s a good world ; knew you of this 
fair work? 
Beyond the infinite and boundlefs reach 
Of mercy, (if thou didil this deed of death) 
Art thou damn'd, Hubert. « 

Hub. Do but hear me. Sin 

Faulc. Ha! I'll tell thee what, 
ThouVt damn'd (o black nay, nothing b fe 

black ; 
Thou art more deep damn'd than prince Uidfir. 
There is not yet ib ugly a fiend* or hell 
As thou fhalt be, if thou didft kill this child. 

Huh. Upon my foul 

Faulc. If thou didft but confent 
To this moft cruel adt, do but delpair. 
And if thou want'ft a cord, the fmalleft thread, 
^hat tver fpider twitted from her womb, 

WiVL 



^Kmg J o H N. 459 

Will ftrangle thee ; a rufh will be a beam 

To bang thee on : or would'ft thoo drown diyfelf. 

Put but a little water in a fpoon. 

And it fhall be as all the ocean. 

Enough to ftifle fuch a villain up. 

1 do fufped thee very grievoufly. 

Hub. If I in ady confent, or fin of thought. 
Be guilty of the dealing that fweet breath, 
Which was embounded in this beauteous clay^ 
Let hell want pains enough to torture me ! 
I left him well. 

Faulc. Go, bear him in thine arms. 
I am amazed, methinks, and lofe my way 
Among the thorns and dangers of this world. 
^ How eafie doft thou take all England up ! 
From forth this morfel of dead Royalty, 
The life, the right, and truth of all this Realm 
Is fled to heav'n ; and England now is left 
To tug and fcramble, and to part by th' teeth 
The un-owed intereft of proud-fwelling State« 
Now for the baro-pickt bone of Majefty, 
Doth dogged war brittle his angry creft % 
And fharleth in the gentle eyes ot peace. 
Now PowVs from home and difcontents at home 
Meetfin one line 2 and vaft confufion waits 
(As doch a Raven on a fick, fallen beaft) 
The imminent Decay of wrefted Pomp. 
Now happy he, whole cloak and cindiure can 
Hold out this tempeft. Bear away the child. 
And follow me with fpeed^ Til to the Kingi 
A thou£md bufinefles are brief at hand. 
And heav*n itielf doth frown upon the Land; 

{Exeunt^ 

7 A point fet liglu Iff Mr. Tbi^Md. 



ACT 



460 Kng J O H N« 

A C T V. SCENE I. 

The CouH of ENGLAND. 
Enter IGng John, Pandulph, and jbUndanis. 

K. John. 

THUS I have yielded up into your hand 
The circle of my Glory, [Gvvn^ the Crorni. 

Pand. Take again 
From this my hand, as holding of the Pope, 
Your fovereign Greatnefs and Authority. 

K, John. Now keep your holy word; go meet the 
French^ 
And from his Holinefs ufe all your power 
To flop the Marches, *fore we are inflam'd. 
Our difcontented Counties do revolt ; 
Our people quarrel with obedience ; 
Swearing allegiance, and the loye of ibul^ 
To ftranger blood, to foreign Royalty j 
This inundation of miftemper'd humour 
Refts by you only to be qualify'd. 
Then paufe not ; for the prefent timers fo fick. 
That prefent medicine muft be miniftred. 
Or Overthrow incurable infues. 

Pand. It was my breath that blew this tempeft up. 
Upon your ftubborn ulage of the Pope : 
But fince you are a gentle convertite. 
My tongue fhall hum again this ftorm of war ; 
And make fair weather in your blaft*ring Land. 
On this Afcenjion-day^ remember well. 
Upon your oath of fervice to the Pope, 
Go I to make the French lay down their arms. {ExU. 
' K.Jobn. Is this Afcenfion-day f did not the Prophet 

Say, 



IGwg Jo H u. 461 

&17, thit b^^re JffcHi/hthJay at noon 
My Crown I ihould give off? even fo I have : 
I did fuppdet it ihould be on conftmiot i 
Biit» heaven be thanked, it is bot vokmcaiy. 

Enter Faulconbridge. 

Faulc. All Kent hath yielded, oodung there holdi 
oat 
But Dover^Ca/iU : London hath itQnv'd, 
JLike a kind hoft, the Dauphin and his Powers. 
Your Nobles %iU not hear you» but are gooe 
To ofier fervice to yeur enetay ; 
And wild amazea^icnt hurries up and down 
The little nuinber of your doubtful friends. 

K. John. Would not my lords return to me agaia^ 
After they heard^ young Arthur was alive P 

Fauk. They foimd him dead, and caft into the 
ftreots. 
An cmptv casket, Where the jewel, life, 
By Tome damn*d hand was robbM and ta'en away. 

K. John. That villain Hubert told me, he did live. 

Fade. So on my foul he did,ibr aught. he Ipiew : 
But wherefore do you droop ? why look you fad ? 
Be goeat in aft, as you have been in thought : 
Let not the world fee fear and fad diftruft 
Govern the ipotion of a kingly eye : 
Be ftirring as the time ; be fire with fire ; 
Threaten the tbreatner, and out^face the brow 
Of bragging horror : fo (hall inferior eyes. 
That borrow their behaviours from the Great, 
Grow great by your example $ and put on 
The dauntlefs ibirit of refolution. 
Away, and glift^ like the God of war. 
When he intendeth to become the field \ 
^ow boidnels iod afptrii^ confidence* 
What, fliaU they, ieek the. Uon in his den^ 

And 






462 *^«g J O H N^ 

And fright him there ? and make him tremble there i 
Oh, let it not be faid ! Forage, and run 
To meet diipleafure farther fi-om the doors i 
And grapple with him, ere he come fo nigh. 

K. Jobn. The Legate of the Pope hath been with 
me. 
And I have made a happy peace with him i 
And he hath promised to difmifs the Powers 
Led by the Dauphin. 

Faulc. Oh inglorious league! 
Shall we, upon the footing of our Land, 
Send fair-piay-orders, and make compromiie, 
Infinuation, parley, and bafe truce. 
To arms invafive i (hall a beardlefs boy, 
A cocker'd, filken, Wanton brave our fields^ 
And flicfli his fpiric in a warlike foil. 
Mocking the air with Colours idely fpread. 
And find no check ? let us, my Liege, to arms : 
Perchance, the Cardinal can't make your peace i 
Or if he do, let it at leafb be faid. 
They faw, we had a purpofc of defence. 

K. Jobft. Have thou the ord'ring of this prefent 
time. 

Faulc. Avf2LY then, with good courage s yet, I 
know. 
Our Party may well meet a prouder fbe. [^Exeuul. 

SCENE II. 
Changes fo tht Dauphin*^ Camp. 

Enter ^ inarms^ Lewis, Salisbury, Melun, Pembroke^ 

Bigot^ and Soldiers. 

Lews. \Ji^ loi^ Melun^ let this be copied cor, 
XVX And keep it ikfe for our remembrance: 

Return 



Ki0fg Jo H N^ 463 

Return the prefident to chefe k>rds again^ 
That having our ^^ order written down. 
Both they and we, perufing o*er thefe notes. 
May know wherefore we took the Sacrament; 
And keep oor faiths firm and inviolable. 

Sal. Upon our fides it never (hail be broken* 
And, noble Daufbm^ albeit we fwear 
A voluntary zeal and un^urg'd faith 
To your proceedings ; yet believe me, Prince, 
I am not glad that fuch a Sore of time 
Should fedc a plaifter by contemn'd revolf 1 
And heal th' inveterate canker of one wound. 
By making many. Oh, it griei^ my foul. 
That I mull draw this metal from my fide 
To be a widow^maker :- oh, and there. 
Where honourable refcue, and defence. 
Cries out upon the name of Salisbury . 
But fuch is the tnfeftion of the time. 
That, for the health and phyfick of our Right, 
Wc cannot deal but with the very hand 
Of ftem injfi^ioe, and confufed wrong. 
And is't not pity, oh, my grieved fiiends ! 
That we the fons and children of this Ifle, 
VFert born to .fee fo iad an hour as this. 
Wherein we ftep after a ftranger March 
Upon her gentle bolbm, and fill up 
Her enemies ranks? (I muft withdraw and weep 
Upon the Spot of this enforced caufe 
To grace the gentry of a Land remote, . 
And follow unacquainted Colours here? 
What, here ? O nation, that thou couldf ft remove ! 
That Neptune*% arms, who clippeth thee about. 
Would bear thee from the knowledge of thyfelf. 
And grapple thee uAto a Pagan ihore ! 
Where theft two f hriftian armies might combine 
The blood of malice in a vein of league. 

And 



464 *«g JOH» 



And not to fpefkl it fo un-n^jliboiirly. 

Lewis. A noble temper doft thou fbtw in this ; 
And great aflfe&ion, wreftling in tbjr bofbm^ 
Doth m^ke an earthquake or Nohilinr. 
Oh, what a noble combat haft thou foughCt 
' Between coqnpulfiont and a brave rcfpeftl 
Let me wipe olBF this honourable dew. 
That filverly doth progrefs on thy cheeks. 
^* My heart hath melted at a lady's tears^ 
*^ Being an ordinary inundation: 
** But this effufion of fuch manly drops, 
^^ This fliow*r, blown up by tempeu of the ibdy 
*^ Startles mine eyes, and makes me more amaz'd» 
*^ Than h^ I ieen the vaulty topof faeav*!! 
^^ Figured quite o*er with burning meteors/* 
Lift up thy brow, renowned Saltshury^ 
And with a great heart heave away this ftonn. 
<^ Commend thefe waters to thofe baby-eyes, 
^^ That never faw the giant world enrag*d ; 
<* Nor met with fortune, other than at feafts, 
*^ Full warm of bloody of mirth, of golSppiog.'* 
Come, come ; for thou fhalt thruft thy Jiaod as dee^ 
Into the purfe of rich profperity^ 
As Lewis himfdtf* ; fb) Nobles, fliaU you aU, 
That knit yovr fiiMiws to the ftrcngth of nine. 

I Bitwien cempiUioii, mJ a brame ftAiff.} Tbk nrnfuf/JB 
was tJie necedity of a leformation in the ttatej whkii, aooani^ 
ing to Sa/ishury*s opinion, (who, in his ijpeech preceding, calls k 
an mfwcii cauft) could onljr be procurea by fiveign arms : Ari 
the brawi rejpi^ was the love or his coantcy. Yet die Oxfiri 



SCENE 



ihg J O H N« 465 

SCENE in. 

Enter Pandolph. 

And evm there, nMthinks^ an angel (tf) fpeeds 1 
Lx>okt where the holy legate comes apace. 
To give us warrant from the hand of heav'n. 
And on our adions fet the nanie of Right 
With holy breath. 

Pami. Hail, noble Prince of Finance ! 
The next is this : King John hath reconciled 
Himielf to Rome ; his (jpirit is come in. 
That fo ftood out againft the holy Church, 
The great Metropolis and See of Rome. 
Therefore thy threatning Cblours now wind up^ 
And tame the favage fpu-it of wild war i 
That, like a Lion fofterM up at hand, 
Ic 0uy iye gently at the foot of peace: 
And be no nmhir harmful than m (hew« 

Lewis. Your Grace fhall pardon me, I will not 
backi 
I am too high-bom to be propertied, 
To be a iecondary at controul ; 
Or ufeful ierving«man, and inftrumenr. 
To any fovereign State throagboot the world. - 
Your breath firft kindled the dead coal of war. 
Between this chaftis'd Kingdom and myfelf ; 
And brought in matter, that fliould feed this fire. 
And now 'tis far too huge to be blown out, 
Vfhh that fame weak wind which enkindled it* 
You taught me how to know the face of Righc^ 
Acquainted me with intVeft to this Land ; 
Yea, thruft this cnterprize into my heart : 
And come ye now, to teil me Jobn hath made 

Vol.. III. H h His 



466 ISmg } o H K. 

IGs peace with Rmef what is that peace to meP 
I) by the honour of mv marriage-bed. 
After young Arthur^ claiin this Land for niine : 
And now it is half-conquered, muft I back, 
Becaufe that JtJm hath made his peace with Rifme? 
Am I R(me*% flave? what penny hath Rome borne;. 
What men provided, what munitbn fent^ 
To under-prop this aftioa ? is*t not I, 
That undergo this charge ? who elfe but I, 
And fuch as to my Claim are liable. 
Sweat in this bufinefs, and maintain this war ? 
Have I not heard thefe iflanders Ihout out, 
Vive ie Roy! as I have bank*d their towns? 
Have I not here the b^ cards for the game. 
To win this eafie match, plaid for a Crown ? 
And fhall I now give o'er the yiekkd Set? 
No, on my foul, it never fhall be faid 
Pand. You look but on the outfide of this work« 
Leuns. Ogtfide or infide, I will not Muni^ 
Till my attempt fo much be glorified. 
As to my ample hope was promifed. 
Before I drew this gallant head of war ; 
And culled thefe fiery fpirits from the work!. 
To outlook Conqueft, and to win Renown 
Ev*n in the jaws of danger, and of death. 

What lufty trumpet thus doth limimon us? 

SCENE IV. 

Enier Faulconbridge. 

Fauk. According to the feir Play of the world* 
Im me have audience : I am fent to fpeak. 



My holy lord of Milam, from the King : 

I come, to learn bow you have dealt for him : 



Aod 



1 



£ing; J o H N/ 467 

And as you anfwer, I do know die ftope 
And warrant limited unto my tonsiic. 

Pand. The Daupbin is too willfuU-oppofite, 
And wUl nbt teniDorrse with my encreaties: 
He flady fays, he^il not lay down his arms. 

Fattlc. By all the blood that ever fury breathed, 
The Youth fays well Now heat our Er^Sfl^ King} 
For thus his Royalty doth fpeak in me : 
He is pospar'd ; and reafon too, he fhould. 
This apim and unnsannerly approach. 
This harnelsM mask^ and unaldvifed rerd. 
This unheard iawcinefi and boyilh troops. 
The King doth fmile at ; and is well-prepar*d 
To whip this dwarfiih war, thefe pigmy arms. 
From out the circle of his Territories. 
That hand which had the ftrength, ev*n at your doof ^ 
To cudgel you, and make you take die hatch ^ 
To dive, like buckets, in concealed wells ; 
To crouch in litter of your ftablo^planks. 
To lye, like pawns, kicked up in cbefts and trunks ; * 
To herd with fwine; to icek fweet iafety ouc. 
In vaults and prlfons ; and to thrill, and fhaJce^ 
£v*n at the crying of our nation's Crow^ 
Thinking his voke an armed E^ti/b man t 
Shall that vidorious hand be feebled here. 
That in your chambers gave you cbaltiiemeHt ? 
No ; know, the gallant Monarch is in arms \ 
And like an Eagle o'er his Aiery towers, 
To fouie annoiance that comes near his neft. 
And you degenerate, you ingrate Revolts, 
You bloody Nero*s^ ripping up the womb 
Of your dear mother England^ blu(h for fhame« 
For your own ladies, and pale-vilag'd maids, 
Like Anuaxm^ come trip^ng after drums ; 
Their Thimbles into armed Gantlets change. 
Their Noodles to Lances, and their gentJe Hearts 

H h 2 To 



468 King J o h k. 

To fierce and bloody inclination. 
Lewis. There end chv Brave^ and 



We grant, thou canft out-fcold us ; brt thee well : 
We hold oar dme too precious to be fpent 
With fuch a babler. 

Pond. Give me leave to fpeak. 

Faulc. No, I will fpeak. 

Ltwis. We will attend to neither : 
Strike up the drums, and let the tongue of war 
Plead for our int'reft, and our being here. 

Faulc. Indeed, your drums, being beaten, will oyout ; 
And fo fliall you, being beaten ; do but ftart 
An Echo with the clamour of diy drum. 
And even at hand a drum is ready braced. 
That ihall reverb*rate all as loud as chine. 
Sound but another, and another fiiall. 
As kxid as thine, rattle the welkin's ear. 
And mock the deep-mouth'd thunder. For at hand 
(Not trufting to this halting Legate here. 
Whom he hath us'd rather for fport, than need) 
Is warlike John ; and in his forehead fits 
A bare-ribbed death ; whole office is this day 
To feaft upon whole thoulands of the Frenclb. 

Lewis. Strike up our drums, to find thi^danger qi£ 

Faulc. And thou fhak find it, Bm^, do not 
<Joubt. lExeimt. 

S C EN E V, 

Changes to a Field of Batfk.^ 

Alarms. Enter King John ani Hubert. 

lL.Jebn. TT O W goes the day with us? ob^tell me, 
XJL Hubert. 
Huh. Badly, I fcarj how fiires your Majefty? 



» 



Xing J o H H. 4^69 

K. Jofm. Thisfcaver, that hath troubled me fi) long, 
Lyet heavy on me: oh, my heart is fick ! 

Mtf. My lord, your valiant kiofman, Faukonbriige^ 
Defires your Majefty to leave the field % 
And fend him word by me which way you go. 

K. John. Tell him, toward Smnfiead^ to the Abbey 
there. 

Mef. Be of good Comfort : for the great Supply, 
That was expe&ed by the Dauphin here. 
Are wreckM three nights ago an GodwthbxAs. 
This news was brought to Richard but ev^n now ; 
The French fight coldly, and rethc th^nfelves. 

K. John. Ah me ! this tyrant feaver burns me up. 
And will not let me welcome thb good news. 
Set on tow*rd Snoinfiead ; to my litter ftrait ; 
Weakneis podcficth me, and I am faint. [ExtmU. 

S C E N E VL 

Changes to the French Camp. 

- Enter Salisbury, Pembroke and Bigot 

^^ T Did not think the King fo ftor'd with fi-iends. 
'•!^|^i; Pemk. Up once amin ; put fpirit in the French : 
if they mifcarry, we mi^rry too. 

SaL That misbegotten devil, Faukonhridge^ 
In fpight of fpight, alone upholds the day. 

femi. They fay. King John^ fore fick, hath left 
the field. 

Enter Melun, wounded. 

Mehn. Lead me to the Revolts of Ewland here, 
Sal. When we were happy, we had ouier names, 

H h 3 Pewbm 



47© £ing John. 

Psmk. It is the Count Melun^ 

Sal. Wounded to death. 

Melun. Fly, noble En^lijb^ you are bought and Ibid \ 
Unthread the rude eye of Rebellion, 
And welcome honie again difcarded 
Seek out King Jobn^ and foil before his fioet : 
For if che French be lords of diis loud day. 
He means to recompence (he pains you takr. 
By cutting off your heads ; thus hath he (worn. 
And I with him, and many more with me. 
Upon the altar at St> Edvtonsbury ; 
£v*n on that altar, where we (wore to you 
Dear amity and everlaftipg love. 

Sal. May this be pofEble! may this be true! 

JMklun. Have I not hideous death within my vkw? 
Retaining but a quantity of life, 
Which bleeds away, ev'n aj a form of wax 
.Reiblveth from its figure 'g^inft the fire ? 
What in the world fhould make me now 
Since I ipuft lofe the u(<; of all deceit ? 
Why fliould 1 then be falfe, fmce it is true. 
That I muft die here, and live hence \yf trpth ? 
I fajr again, if Lewis do win the day. 
He is forfworn, if e'er thc^ eyes of yours 
Behold another day break in the eaft. 
But ev'n this highr, whofe black contagious breath 
•Already fmoaks about the burning creft 
Of the old, feeble, and day» wearied ftin, 
Ev-n thjj ill night, your breathing fbali expire ) 
Paying the fine of rated treachery, 
£v*n with a treacherous fine of all your fives. 
If Lewis by your aflliftance win the day. 
Commend me to one Huberty with your King j 
The love of him, and this refpeft befideS| 
(For that my grandfire was an EngUJbman^ 
Awakes my confcience to confefs all this. 



ISflg J OH M. 471 

In lieu whereof^ I pray yos, bear tne hence 

From forth the noife and rumour of the field ; 
. Where I may think the remnant of my thoughts- 

In peace ; and part this body and my ibul» 

With Gonteoi^lation, and devout defires. 

Sal. We do believe thee, and beflirew my foul 

But I do love the fiivour and the form 

Of this mpfl: fair oGcafion» by the which 
\ We will untread the fteps of damned flight ; 

And, like a bated and retired flood, 

liCaving our ranknefs and irregular courie. 

Stoop low within thofe bounds, we have o^er-IookM \ 

And calmly run on in obedience 

£v*n to our ocean, to our great King John. 

My arm (hall give thee help to bear thee hence^ 

For I do fte the cruel pangs of death 

(tf) Pight in thine eye. Away, my friends; new 
ffight ; 

And happy newneis, that intends old right f 

[Exeunt^ Uadif^ ^Mclun; 

S C E N E Vlt 

Changes to a different part of the French Caff^s 

Enter Lewis, and Ins Train. 

J>wii.TpHE fun of hcav'n, mcthought, was loth 

1 to fet^ 
But ftaid, and made the weftem wdkin blufh ; 
W hen th' Englifl) meafor'd backward theif own ground 
In faint retire: oh, bravely came we off. 
When with a volley of our needleft (hot. 
After fuch bloody toil, we bid good n^bt; 

[ W Pighi^ 0*/&r^ Edition Vulg, R^kt.\ 

H h 4 And 



47* J^ J o H ». 

And wound our tstter*d colours clearly up, 
Laft to chc field, and almoft lords of it!< 

Enter a Mejfenger. 

Mef. Where is my prince, the Da$^nf 

Lewis. Here; what news? 

Mef. The count Jkklun is flain ; the Et^U/b lords 
By his pcrfwafion are again faii'n off ; 
And your fupply, which you have wi(hM io long. 
Are caft away, and funk on Godwin fands. 

Lewis. Ah foul, fhrewd, news I Beihrew cfay very 
heart, 
I did not think to be fad to night. 
As this hath made me. Who was be, that iaid. 
King John did fly, an hour or two before 
The (tumbling night did part our weary powers? 

Mef. Who ever fpoke it, it is true, my lord. 

Lewis. Well ; keep good quarter, and good cut 
to night \ 
The day (hall not be up fo loon as T, 
^ To try the fair adventure of to morrow, \Exiiad. 

SCENE VIIL 

jfn open Place in the Neighbourhood ofSmsA^ 

\4bbey. 

Enter Faulconbridge, ani Hubert, feveraUy. 

Huh'^LTHCfs there? fpeak, ho! fpcak quickly, 
VV' or I Ihoot. 
' 1 FauU^ A friend. What art diou ? 
Hntt. Of the part of England. 
J^aule. And whither doft thou go ? 
HuK What's that to thee ? 
Why may not I demand of thine afiajrs, 
As well a$ thou of mine ? 

Fanic. 



Xhg JoHU. 473 

Fatdc. Hubirt^ I think. 
HiA. Thou haft a perfeft thought: 
I wiU upon all hazards well bdieire 
Thou art my fnend» that koow'ft my tongue fo well: 
Wto art thou ? 

FmIc. Who thou wilt; and, if thou pleafi^ 
Thou noay^fl: be*firiend me b much, as to think> 
I come one way of the Plant a£€9ets. 
Hub. Unkind lemembranoel X thou and eyelels 
night 
Have done me (hames brave foldier, pardon me^ 
That any accent, breaking from thy too^;ue^ 
Should teape the true aopiaintance of mme ear. 
Fade. Come, come ; fans comfUmiut^ what news 

abroad? 
Hub. Why here walk I, in the black brow of nighty 
To find you out. 

Faulc. Brief then ; and what's the news ? 
Hub. O my fweet Sir, news fitting to the night i 
Black, fearful, comfortlelsy and horrible. 

Fauk. Shew me the very wound of this ill news,^ 
I am no woman, I^ not fwoon at it. 

Hub. The King, I fear, is poifon*d by a Monk; 
I left him almoft fpeechlefs, and broke out 
T* acquaint you with this evil ; that you might 
The better arm you to the fuddei^ time. 
Than if you had at leifure known of this. 

Faulc. How did be take it ? who did tafte to him ? 
Hub. A monk, I tell you ; a rdblved villain, 
Whofe bowels fuddenly ourft out ; the King 
Yet fpeaks ; and, peradvencure, may recover. 
Faulc. Who didft thoQ leave to tend his Majefty f 



z tbou M$d cndfefi i^hi^ We IhouM lead^ ffilifs. So 

T^f/r^r calls the Moon^ }i» i^ 9f nigbi. 



474 JSng JouH. 

Huh Why» know yoo not? tke Joids are all come 
bock^ 
And brought Prince /ftiri^ m tfadr oompany I 
At ^fffaofir rapieft the King hath pttdon'd tbem^ 
And they are all about his Majeftjr. 

Fautc. With^hold (bine nidignacion^ mighty heaven I 
Andrtempt us not to bear above oar power. 
I'll tell thee, Hukrt^ hdf my powers this nigbCft 
Paffiag tbefe flats» are taken by the tide; 
Thefe JUncoln^wtShts have devoured them % 
Myfelf, well noouoted, hardlf hive efeaped. 
Away, before^ <;oiidiift me to the King; 
I doob^ he will be dead, or e*er I come. [AMnr. 

SCENE IX. 

m 

Changes to the Orchard in Swinflead j&he^. 

Enter Prince Henry, Salisbury and Bigot. 

Henry.T T is too late; the life of all his blood 

X Is touched corruptiblv i and his pure brab, 
(Which, ibme fuppole, the fours frail dwelling houie,) 
Etoth, by the idle comments that it oiakes^ 
Foretel the ending of mortality. 

Enier Pembrbke. 

PemK His highnefs yet doth ipeak, and holds 
belief. 
That, being broqght into the open air. 
It would allay the burning quality 
Of that fell poifon, which aflaileth him. 

Henry. Let him be brought into the orchard here; 
Doch he ftill rage? 

Pemb. He is more patient. 
Than when you left him } even now he fung. 

Henry. 



#5teg; J o H N* 475 

Henry. O vanky cS ficknefsl fierce extreims 
In their continuance will not feel themfdves. 
Deadi hairing prtfd upon the outwatd parts. 
Leaves them (a) infenfible ; his fi^ is now^ 
Againft the mmd % the which he pricks and WQUilds 
With many legions of ilrange fantaiies ; 
Which, ui their throng, and prels to that laft hold, 
Cbnfound themfelves. 'Tis ftrange that death flioukl 

fing: — 
I am the cygnet to thb pale, fidht fwan. 
Who chaunts a doleful hymn to his own deaths 
And, fix>m the of^an^^niije of ftiiky, fing^ 
His foul and body to tneir laftiog reft* 

Sal. Be of good comfort, Prinoei Sot you art bom 
To fet a form upon that indigtft. 
Which he hath left fo ihapdefs and £> rude*. 

King John brought m. 

K. John. Ay, ms^ry, now my foul hath dbow^i 
roomi 
It would not oift at windows, nor at doora. 
There is fi> hot a fummer in my boibm. 
That all my bowels crumble up to duft : 
I am a (cribbled form drawn with a pen 
Upon a parchment| an4 agaiol^ this fire 
Do I Ihrink up. 

Henry. How fares your Majefty I 

K. John. Poifon^d, ill fare I dead, forfook, caft ofi^» 
<* And none of you will bid the winter com^ 
** To thrud his icy fingers in my maw % 
f ' Nor let my kingdom^s rivers take their courle 
** Through my burn'd bofom : nor intreat the north 
** To make his bleak winds kiis my parched lips, 
f^ And cocnfoft me with co)d/* I ask not much, 

^[a) h/enfiili. 0;r/«ri Edition — Valg. inviftb.'] 



47^ JtiMg J O H K. 

I beg cold GomCbrt } and yoo arc fo ftnuc» 
And fo unmtefult you deny me that. 

Hemy. Oh, that there were Some virtue in my teari» 
That might reUeve you! 

K. Jom. The fait c^ them is hot. 
Within me is a hell ^ and there the poifon 
by as a ficndt confin'd to tyrannize 
Gta unreprievaUct condemned blood. 

SCENE X. 

EfUiT Faulconbridge. 

Faulc. Oh ! I am fcalded with my violent modoni 
And fpken of (peed to fee your Msyefty. 

K^Jobih Ob! coufin, thou art come to fet mine 
eye: 
The cackle of my heart is crackt and burnt ; 
And all the fhrowds, wherewith my life ihouU (ail» 
Are turned to one thready one little hair : 
My heart hath one poor ftring to ftay it by» 
Which holds but tfll thv news be uttered i 
And then all this thou feeft, is but a clod. 
And module of confounded royaky. 

FauU. The 2Xi»r/fcff is preparmg hitherward. 
Where, heav'n he knows, how we (hall anfwer him. 
For, in a night, the beft part of my power. 
As I upon advantage did remove. 
Were in the wafiies, all unwarily, 
Devoi^red bv the unezpefted flood. {Th Khg Ses. 

Sal. You breathe the(edead news in as dead an ear: 
My Liege! my Lord!— —but now a King - 
now thus. 

Hemy. £v*n (b muft I run on, and ev*n (b ftop. 
What wety of the world, what hope, what ftav. 
When this was now a King, and now is clay r 



King J o H n: 477 

FmmU. Art thou gone fof I do but ftay behind^ 
To do the office for thee of rereDge: 
And then oiyNToul (hali wait on tboe to heav'n, 
Aa it on earth hach been thy fervant ftill. 
Now, now, yoQ dan, that move in your bright fphereSf 
Where be your pow'rt P (hew now your mended &iths» 
And inftancly return with me again. 
To pu(h deftruftion and perpetual (hame 
Out of the weak door of our fainting land : 
Strait let us fcek, or ftrait we (hall be ibught ; 
The Dauphin rages at our very heels. 

Sal. It feems you know not then fi> much as we: 
The Cardinal PanMfb is within at reft. 
Who half an hour fines came from the Dauphm \ 
And brings from him fuch offers of our peace. 
As wd with honour and refpeft may take. 
With purpofe prefently to leave this war. 

Fauk. He will the rather do it, when be fees 
Ourfelves well finewed to our defence. 

Sal. Nay, it ,is in a manner done already \ 
For many Carriages he hath difpatch'd 
To the fea-fide^ imd put his Caufe and Quarrel 
To the difpofing of the Cardinal : 
With whom yourfelf, myfelf, and other lorcis. 
If you think meet, this afternoon will poft 
To confummate this bufinefs bappiiy. 

FauU. Let k be fo ; and you, my noble Prince, 
With other Princes that may beft be fpar*d. 
Shall wait upon your &ther*s Funeral. 

Henry. At fForcefter muft bis body be bteri^d. 
For fo he wiird il 

Fauk. Thither (hall k then. 
And happily may your fwect lelf put on 
The lineal State, and Glory of the LandU 
To whom, with all Submifik>n on my knee» 
I do bequeath my faithful fervices, 
And true fubjeAion everlaftingly. 

SaL 



478 Xsttg J O H M. 

Si^. And the \ikt tender of our lo^e wc make^ 
To reft without si Skxx for evermore. 

Henry, 1 have a iiod fi>ul» that would give yoo 
thanks. 
And knows not how ta do it, but with tears, 

Fauk. Oh, let us pay the time but needful woe. 
Since it hath been before4iand with our gridi. 
(a) Thus Engkmd never did, nor never ikall,- 
Lye tu the proud foot of a Cbnqueror, 
But when it firft did help to wound itfelf. 
Now thefe her Princes are come home ag^n. 
Come the three corners of the world in arms. 
And we (hall fhock them ! — Nought Ihall make us rue, 
If England to itielf do reft but true. [E:^unt mms: 

I [a] Hni. Oxford Editor Wvi^ TUs. ] 



ne End of the third Volume^ 




r 



A 



^